KEGG   Sodalis glossinidius (Glossina spp.): SG0423Help
Entry
SG0423            CDS       T00316                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06195  ApaG protein
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SG0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: BAE73698
UniProt: Q2NVX7
Position
complement(745770..746147)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCVQVQSMYIETQSQPESDRYVFAYTITLRNLGRHPVQLIGRYWLITNANGQET
EVQGEGVVGEKPRILPGGEFQYTSGAVLETPLGTMQGHYDMVDDQGQGFHVAIPVFRLAI
PSLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaactcgccccgtgtctgtgttcaggttcagagcatgtacatcgagacgcagtct
cagccggaaagtgatcgttatgtctttgcttataccatcacgctgcgcaatttgggtcgg
caccctgtgcagctgataggacgttactggttgatcaccaatgccaacggtcaagagaca
gaggttcagggcgagggcgtcgtcggtgaaaagccgcgcattctgcccggtggcgagttt
caatacaccagcggcgcggtgctggaaacccctctgggtaccatgcaaggccattacgat
atggtcgatgaccaaggacagggatttcacgttgccatccccgtcttccgcctggcgatt
ccttctcttataaactaa

DBGET integrated database retrieval system