KEGG   Sodalis glossinidius: SG0959
Entry
SG0959            CDS       T00316                                 

Definition
(GenBank) two-component system response regulator
  KO
K07771  two-component system, OmpR family, response regulator BasR
Organism
sgl  Sodalis glossinidius
Pathway
sgl01503  Cationic antimicrobial peptide (CAMP) resistance
sgl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SG0959
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SG0959
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sgl02022]
    SG0959
Two-component system [BR:sgl02022]
 OmpR family
  BasS-BasR (antimicrobial peptide resistance)
   SG0959
SSDB
Motif
Pfam: Response_reg Trans_reg_C FleQ
Other DBs
NCBI-ProteinID: BAE74234
UniProt: Q2NUE1
Position
1581865..1582533
AA seq 222 aa
MKILVIEDDKLLREGLQQALEQESFACECASNLGQSWPLLTSTTYSLIILDLGLPDGDGM
TLLEKLRRQGNGVPVLILTARDAIDERVRGLDFGADDYLIKPFALSELLARSRAIIRRHQ
GVSNNLLWVDDISLDLTHHDVTVDGKAVILTPKEFAILSRLMLRAGHRIHREILHQDLYS
WDDDPSSNSLEVHIHHLRQKIGRGRIQTLRGFGYLLTTAEKS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgaaaattttggtcattgaggacgataaactcttgcgggaaggcttgcagcaggcgctg
gagcaggaaagttttgcctgtgaatgcgcctctaatctgggtcaaagctggccgttattg
acctccacgacttatagcctgattattcttgatttaggtttgccggacggcgatgggatg
actctgctggaaaaacttcgccggcagggcaacggcgtgccggtattaatcctgaccgcg
cgtgacgcgattgacgagcgggtacgcggcctggatttcggcgcagacgattatctgatt
aaaccctttgcgctgagcgaattattggcccgctcccgggccatcattcgccgtcatcag
ggtgtcagtaataacctgttgtgggtcgatgatatttctctggatttgacccaccatgat
gtcaccgtggacggtaaagcggtcatcctgaccccgaaggagtttgcgatcctctcccgg
ctgatgttgcgggcggggcatcgcattcatcgtgaaatcctgcatcaggatctttacagt
tgggatgatgatccttcctccaactcgctcgaagtgcatattcatcatctgcgccagaaa
ataggccgtggccgtatccagacgctacgtggcttcggttatcttctcaccaccgcagaa
aaatcatga

DBGET integrated database retrieval system