KEGG   Sodalis glossinidius (Glossina spp.): SG1398Help
Entry
SG1398            CDS       T00316                                 

Definition
(GenBank) tryptophan synthase beta subunit TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00260  Glycine, serine and threonine metabolism
sgl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01130  Biosynthesis of antibiotics
sgl01230  Biosynthesis of amino acids
Module
sgl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SG1398
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SG1398
Enzymes [BR:sgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SG1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Mic1
Motif
Other DBs
NCBI-ProteinID: BAE74673
UniProt: Q2NT52
Position
complement(2321838..2323028)
Genome map
AA seq 396 aa AA seqDB search
MTRLNPYFGEFGGMYVPQILMPALIQLEDAFVSAQSDPAFQAEFSDLLTNYAGRPTPLTL
CRNLTAGTRTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
SSALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSDSY
ERAHYMLGTAAGPHPFPTIVREFQRMIGEETRAQLQEHEQRLPDAVIACVGGGSNAIGMF
ADFIDEPAVRLIGVEPGGLGIETRQHGASLKHGRTGIYFGMKSPMMQSAEGQIEESYSIS
AGLDFPSVGPQHAYLDSIGRAEYISATDEEALDAFRRLSRHEGIIPALESSHALAHALRM
IQAEPEKEQILVVNLSGRGDKDIFTVHDILKARGDI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacgacttaatccctattttggcgagtttggcggcatgtatgtgccgcaaatcctg
atgcctgcgctgattcagctggaagacgcgttcgtcagcgcccagagcgacccggcgttt
caggccgaattcagcgatttgctgacaaactacgccggccgaccgaccccgctcacgctg
tgccgcaacctgaccgccggcacccggaccaaactttatctcaaacgcgaagacctgctg
cacggtggcgcccataaaaccaaccaggtgctggggcaggcgctgctggccaaacggatg
ggcaaaactgaaatcatcgccgaaaccggcgccggtcagcacggcgtggcctccgccctg
tcctccgcactgctggggctgaaatgccgtatttatatgggcgccaaagacatcgaacgc
cagtctcccaatgtttttcgcatgcggctgatgggcgccgaggtcattccggtgcacagc
ggctcctccaccttaaaagacgcctgcaacgaagcgttgcgcgactggtccgatagctat
gagcgcgcccactacatgcttggcaccgccgccggcccgcatccgttcccgaccatcgtg
cgcgaattccagcgtatgatcggcgaggaaacgcgcgcgcagctgcaagagcacgagcag
cgcctgccggatgcagtcatcgcctgcgtcggcggcggctctaacgccatcggaatgttc
gccgatttcatcgatgaaccggcggttcgcctgataggcgtagagccgggcggcctgggt
atcgagaccaggcagcatggggcgtcgttgaaacacggccgcaccggcatctatttcggt
atgaagtcgccgatgatgcaatccgccgaagggcagatcgaggaatcctactccatatcg
gccggcctggattttccctcggtgggtccccagcatgcctaccttgatagcataggcagg
gcggagtacatatctgctaccgacgaagaagccctggatgccttccgtcgcctttcccgc
catgagggcattattccggcgctggaatcgtcccatgcgctggcccacgcgctgagaatg
atacaagcggaaccggagaaggagcagatcctggtggtcaacctgtccggccgtggcgat
aaagatattttcaccgttcatgatattctgaaggcgcgaggagacatttaa

DBGET integrated database retrieval system