KEGG   Sodalis glossinidius (Glossina spp.): SG1751Help
Entry
SG1751            CDS       T00316                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00020  Citrate cycle (TCA cycle)
sgl00620  Pyruvate metabolism
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01120  Microbial metabolism in diverse environments
sgl01130  Biosynthesis of antibiotics
sgl01200  Carbon metabolism
Module
sgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SG1751
   00620 Pyruvate metabolism
    SG1751
Enzymes [BR:sgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SG1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo
Motif
Other DBs
NCBI-ProteinID: BAE75026
UniProt: Q2NS49
Position
2996625..2998244
Genome map
AA seq 539 aa AA seqDB search
MKENFIAALGMTVSASAKQHQVVDNPPVDIILIGGGVMSATLGTYLKALEPGWTIHMYER
LEKTAEESSNGWNNAGTGHAAFCELNYTTLSPAGSVDISKAVAVNESFEISRQFWAYLVK
QKILTNPQSFINNVPHMSFVWGEDNIRFLRQRFDALQTSTLFRGMEYSENPQQIREWAPL
VMDGRDTFQKVAATRMAMGTDVNFGEMTQQLLAALQQYPQFHLHLQHDVVDIKRNADQTW
SVRVADHSNGGRQSTVCARHVFIGGGGASLTLLQKSGIPEVNGYAGFPVGGQFLVATNPE
VVGHHHAKVYGKASVGAPPMSVPHIDTRILDGKQALLFGPFATFSSKFLKRGSWLDLFHS
LTRQNLLPMLRVGLDNFGLMRYLIGQLLMSDKDRLNALREYYPQATMADWSLIEAGQRVQ
VIKKDAGKGGILQFGTEVVSSADGSLSVLLGASPGASTAAPIMLELLASMFKEQVTTDAW
QRKLKEMVPSYGQTINGNLALTNEIRLSTSEVLGLTYIEAKPLPGEPADGKWEGLQKAM
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaattttatcgcagcccttggcatgacggtctctgcgtcagccaaacagcat
caggttgtggataaccccccggtggacatcatactgattggcggcggagtcatgagcgcc
acgctgggaacttatctgaaagcgcttgagccgggctggaccattcatatgtatgagcgt
ctggaaaaaacggcagaggaaagttctaacggctggaacaatgccggcaccggccatgcc
gcattctgcgagctgaactacaccacgctcagcccggcgggttcggtggatatctctaaa
gcggtcgcggtaaacgaatcttttgaaatatcacgccagttctgggcctatctggtaaag
caaaaaattctcaccaatccgcaaagctttatcaataatgtcccgcatatgagcttcgtg
tggggagaagacaatatccgctttctacgccaacgcttcgatgcgctgcaaaccagcacg
ctgttccgcggcatggagtactctgaaaacccgcagcagatccgcgaatgggcgccgctg
gtcatggatggacgtgacacatttcaaaaagtggcagccacccgtatggctatgggcacc
gacgtgaacttcggtgagatgacgcagcaattgctggcggcgttacagcaatacccccag
tttcatttgcatcttcagcatgacgtggtggatatcaagcgcaacgccgatcaaacatgg
agcgtgcgtgttgccgatcacagcaatggcggccgacagtccacggtgtgcgcccgccat
gtctttatcggcggcggtggcgcgtcactgaccctgctgcaaaaatctggcattcccgag
gtaaatggctatgccggcttcccggttggcgggcaatttctggtcgcgaccaatcccgag
gtggttggccaccatcacgccaaagtgtacggtaaagcgtcggtcggcgcgccgccgatg
tcggtgccgcatatcgatacccgtattcttgacggcaagcaggcgctgctgttcggcccg
tttgccacctttagcagcaaattcctcaagcgagggtcctggctggatttgttccattcg
ctcacgcggcaaaacctgttgcccatgctgcgcgtcgggctggataacttcggactgatg
cgctatctcatcggccagttgctgatgtcggataaagatcgcctgaatgccctgcgcgaa
tattatccccaggccacaatggctgattggtcgctgattgaggccggccagcgggtgcag
gtgatcaaaaaagatgccggcaaaggcggtattttgcagttcggcaccgaagtagtcagc
tcggccgacggctcgctgtcggtgctgcttggcgcttcgcccggcgcctccaccgctgcc
cccatcatgctggagcttttggcctcgatgtttaaagagcaggtgaccaccgatgcctgg
cagcgaaaactgaaagagatggttccctcctacggccagacgattaacggtaaccttgca
ctgaccaatgagattcgtctctcgacctccgaggtcctggggctgacctatatcgaggcc
aaacccttgcccggcgagccggcagacggcaaatgggaagggctgcaaaaagcaatgtaa

DBGET integrated database retrieval system