KEGG   Sodalis glossinidius: SG2178
Entry
SG2178            CDS       T00316                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgl  Sodalis glossinidius
Pathway
sgl00010  Glycolysis / Gluconeogenesis
sgl00030  Pentose phosphate pathway
sgl00051  Fructose and mannose metabolism
sgl00052  Galactose metabolism
sgl00680  Methane metabolism
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01120  Microbial metabolism in diverse environments
sgl01200  Carbon metabolism
sgl01230  Biosynthesis of amino acids
sgl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG2178
   00030 Pentose phosphate pathway
    SG2178
   00051 Fructose and mannose metabolism
    SG2178
   00052 Galactose metabolism
    SG2178
  09102 Energy metabolism
   00680 Methane metabolism
    SG2178
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SG2178
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgl01009]
    SG2178
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgl03019]
    SG2178
Enzymes [BR:sgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SG2178
Protein phosphatases and associated proteins [BR:sgl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SG2178
Messenger RNA biogenesis [BR:sgl03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SG2178
SSDB
Motif
Pfam: PFK NAD_kinase
Other DBs
NCBI-ProteinID: BAE75453
UniProt: Q2NQX2
Position
complement(3791678..3792640)
AA seq 320 aa
MIKKIGVLTSGGDSPGMNAAIRGVVRAGLSEGLEVYGIYDGYLGLFQDRIAKLDRYSVSD
MINRGGTFLGSARFPEFREEGTRAIAIENMTKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHQRISIVEVMGRYCGDLTMA
AAIAGGCEFIVLPEVEFKPEDLVYEIKAGIAKGKKHAIVAITEYICNVAELAQYIEKETG
RETRATVLGHIQRGGRPVAYDRILASLMGAYSIELLLQGYGGRCVGVQNERLVHHDIVDA
IENMKRPFRSNILETAKKLF
NT seq 963 nt   +upstreamnt  +downstreamnt
atgattaaaaaaatcggtgtactgacaagcggcggtgattcaccaggaatgaatgcggcc
atccggggcgtggtacgggccgggctttccgaaggcctggaggtctacggcatttatgac
ggttacctgggcctgtttcaggatcggatagcgaaactggaccgttatagcgtttcagat
atgattaaccgcggcggcacctttcttggttctgcgcgttttccggaatttcgagaggaa
ggcacccgcgctatcgcgattgagaacatgaccaaacgtggtctggatgcgctggtggta
atcggtggcgatggttcctacatgggcgccaagcgtttgaccgaaatgggtttcccctgc
attggcctgccgggcacgattgataatgacgtggcgggcaccgattacaccattggctac
ttcaccgcgctggaaaccgtcgtcgaggccattgaccggctgcgcgatacatctacgtca
catcagcgtatttctattgttgaggtcatgggccggtattgtggcgatctgaccatggcg
gctgctattgccggcggctgtgagttcatcgtgttgcctgaagtggaattcaaaccggaa
gacctggtctacgaaatcaaggcgggtatcgctaagggtaaaaaacacgccattgtcgcg
attaccgaatacatctgtaatgttgctgagcttgcgcaatatattgaaaaagagacggga
cgggaaacccgcgccaccgtactgggtcatatccagcgcggcggtaggccggtggcttac
gaccgtattttggcctcgctcatgggtgcctattctattgaactgctgttgcagggctac
ggcggccgttgcgtcggggtgcaaaacgagcgactggtgcatcacgacatcgtcgacgcc
attgaaaatatgaaacgtcctttccgcagcaatatcctggaaacggcaaaaaaactcttc
tga

DBGET integrated database retrieval system