KEGG   Sodalis glossinidius (Glossina spp.): SG2178Help
Entry
SG2178            CDS       T00316                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00010  Glycolysis / Gluconeogenesis
sgl00030  Pentose phosphate pathway
sgl00051  Fructose and mannose metabolism
sgl00052  Galactose metabolism
sgl00680  Methane metabolism
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01120  Microbial metabolism in diverse environments
sgl01130  Biosynthesis of antibiotics
sgl01200  Carbon metabolism
sgl01230  Biosynthesis of amino acids
sgl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG2178
   00030 Pentose phosphate pathway
    SG2178
   00051 Fructose and mannose metabolism
    SG2178
   00052 Galactose metabolism
    SG2178
  Energy metabolism
   00680 Methane metabolism
    SG2178
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SG2178
Enzymes [BR:sgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SG2178
Protein phosphatases and associated proteins [BR:sgl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SG2178
Messenger RNA biogenesis [BR:sgl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SG2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAE75453
UniProt: Q2NQX2
Position
complement(3791678..3792640)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRGVVRAGLSEGLEVYGIYDGYLGLFQDRIAKLDRYSVSD
MINRGGTFLGSARFPEFREEGTRAIAIENMTKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHQRISIVEVMGRYCGDLTMA
AAIAGGCEFIVLPEVEFKPEDLVYEIKAGIAKGKKHAIVAITEYICNVAELAQYIEKETG
RETRATVLGHIQRGGRPVAYDRILASLMGAYSIELLLQGYGGRCVGVQNERLVHHDIVDA
IENMKRPFRSNILETAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggtgtactgacaagcggcggtgattcaccaggaatgaatgcggcc
atccggggcgtggtacgggccgggctttccgaaggcctggaggtctacggcatttatgac
ggttacctgggcctgtttcaggatcggatagcgaaactggaccgttatagcgtttcagat
atgattaaccgcggcggcacctttcttggttctgcgcgttttccggaatttcgagaggaa
ggcacccgcgctatcgcgattgagaacatgaccaaacgtggtctggatgcgctggtggta
atcggtggcgatggttcctacatgggcgccaagcgtttgaccgaaatgggtttcccctgc
attggcctgccgggcacgattgataatgacgtggcgggcaccgattacaccattggctac
ttcaccgcgctggaaaccgtcgtcgaggccattgaccggctgcgcgatacatctacgtca
catcagcgtatttctattgttgaggtcatgggccggtattgtggcgatctgaccatggcg
gctgctattgccggcggctgtgagttcatcgtgttgcctgaagtggaattcaaaccggaa
gacctggtctacgaaatcaaggcgggtatcgctaagggtaaaaaacacgccattgtcgcg
attaccgaatacatctgtaatgttgctgagcttgcgcaatatattgaaaaagagacggga
cgggaaacccgcgccaccgtactgggtcatatccagcgcggcggtaggccggtggcttac
gaccgtattttggcctcgctcatgggtgcctattctattgaactgctgttgcagggctac
ggcggccgttgcgtcggggtgcaaaacgagcgactggtgcatcacgacatcgtcgacgcc
attgaaaatatgaaacgtcctttccgcagcaatatcctggaaacggcaaaaaaactcttc
tga

DBGET integrated database retrieval system