KEGG   Sodalis glossinidius (Glossina spp.): SGP2_0020
Entry
SGP2_0020         CDS       T00316                                 

Definition
(GenBank) hypothetical protein
Organism
sgl  Sodalis glossinidius (Glossina spp.)
SSDB
Motif
Pfam: DUF4354
Other DBs
NCBI-ProteinID: BAE75781
UniProt: Q2NPZ4
Position
pSG2:complement(23412..23606)
AA seq 64 aa
MCLKAYNGHGKSFKLDTIDDTLTTEKLAPKKTLKGIAVFSSNDESVYDASMVKLSDDCDS
HDNK
NT seq 195 nt   +upstreamnt  +downstreamnt
ttgtgtcttaaagcctataatggacacggaaaatccttcaaactcgacaccattgatgat
acgttaacaactgaaaaactggcccctaaaaaaacattgaaaggtattgctgtattttcc
tcaaatgatgagtcggtttatgacgcctccatggttaaactgagcgacgattgcgatagc
cacgataataaataa

DBGET integrated database retrieval system