KEGG   Streptococcus gordonii: SGO_1788
Entry
SGO_1788          CDS       T00594                                 

Name
(GenBank) pyruvate formate-lyase
Organism
sgo  Streptococcus gordonii
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABV09509
UniProt: A8AZ47
Position
complement(1861040..1863481)
AA seq 813 aa
MIQVKEVERTTIKTDYFGSLTERMNKYREDVLNKKPYIDAERAVLATKAYDEHKEKPNVL
KRAYMLQEILENMTLYIEDETMIVGNQASSNKDAPIFPEYTLEFVLNELDLFEKRDGDVF
YITEETKEQLRSIAPFWENNNLRARAGALLPEEVQVYMETGFFGMEGKMNSGDAHLAVNY
QKLLAYGLKGFEEKARAAKEALDLTDPASIDKYHFYDSIFIVVNAVKAYAERFVALANQL
AEKADPKRRQELLEIARICSKVPYEPASTFAEAVQSVWFIQCILQIESNGHSLSYGRFDQ
YMYPYVKADLEAGRETEASIVERLTNLWIKTITINKVRSQAHTFSSAGSPLYQNVTIGGQ
TRDKRDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDARFMNECIEVMKLGFGMPAFNN
DEIIIPSFIAKGVLEEDAYDYSAIGCVETAVPGKWGYRCTGMSYMNFPKVLLITMNDGID
PASGKRFAPSFGHFKDMKSFAELQTAWDKTLRHLTRMSVIVENSIDLSLEREVPDILCSA
LTDDCIGRGKHLKEGGAVYDYISGLQVGIANLSDSLAAIKKLVFEEGRLTPAELWHALET
DYAGERGKEIQEMLIHDAPKYGNDDDYADKLVTDAYDIYVDEIAKYPNTRYGRGPIGGIR
YSGTSSISANVGQGRGTLATPDGRNAGTPLAEGCSPSHNMDKNGPTSVLKSVSKLPTDEI
VGGVLLNQKVNPQTLSKEEDKLKLIALLRTFFNRLHGYHIQYNVVSRETLIDAQKHPEKH
RDLIVRVAGYSAFFNVLSKATQDDIIGRTEHTL
NT seq 2442 nt   +upstreamnt  +downstreamnt
atgatccaagtaaaagaagtagaaagaacaacaataaaaacagactattttggtagtctg
acagagagaatgaataaatatcgtgaagatgttttaaataaaaagccctacattgatgca
gagcgcgctgtcctagctaccaaagcttacgatgagcataaggaaaagccaaatgtgttg
aaacgtgcttatatgctccaagagattttggaaaatatgacgctttacattgaagatgaa
acgatgattgttggtaatcaagcttcatctaacaaagacgcgcctatcttcccagagtat
actttagagtttgtactcaatgaactagatctttttgagaaacgggacggagacgtcttc
tatattacagaggaaaccaaagagcagctccgtagcatcgctcctttctgggaaaataat
aacctccgtgctcgagctggcgctttacttccagaggaagttcaggtttatatggaaact
ggcttctttggcatggaaggaaagatgaactctggggatgcccacttggcggtcaactat
caaaaactcctggcttatggactgaaaggttttgaagaaaaagctcgcgcagctaaggaa
gctttggatttaaccgatccggctagtattgacaaataccacttttatgattccattttc
atcgtagtcaatgcggtgaaagcttatgcggagcgttttgttgctttggccaatcagctg
gctgaaaaagcagatcctaagcgtcgtcaggagctcttagaaatcgctagaatctgttct
aaagtaccatatgagccagcatcaacctttgctgaagctgttcagtctgtttggtttatt
cagtgtattcttcagatcgagtccaacggacattcactctcttatggtcgctttgaccag
tacatgtatccttatgtcaaggcagatttggaagctggacgtgagacagaggctagcatt
gtggaacgcttaaccaatctctggattaagacaattaccattaataaagtgcgcagtcag
gcccacacattctcatctgcgggaagtcccctttatcaaaatgtgacaatcgggggccaa
acgagagataagagagatgcagtcaacccactttcctaccttgtcttgaaatctgtagct
caaactcatcttcctcagccgaatctgactgttcgttatcatgcaggcttagatgctcgc
tttatgaatgagtgtattgaagtcatgaagctaggtttcggtatgccggctttcaataat
gatgaaatcatcattccgtcctttatcgccaaaggcgttttagaagaagatgcatatgac
tatagtgctatcggctgtgtggaaactgctgtgcctggtaaatggggctaccgttgtaca
ggtatgagctatatgaacttccctaaggtgctcctcatcactatgaacgatggaattgac
ccagcatctggcaagcgctttgcaccaagctttggtcactttaaagatatgaagagtttt
gctgagctgcaaacggcttgggacaagaccttgcgccacttgacccgcatgagtgtcatc
gtggaaaattctattgacctgtctcttgaaagagaagtgccggatattctctgctcagct
ttgacagatgactgtatcggacgcggtaagcatttgaaagagggcggagctgtctatgac
tatatttccggtcttcaagtcggtattgccaatctatcagactcattggcggctatcaaa
aaactggtctttgaggagggtaggctgactccagctgaactatggcatgcacttgaaacg
gactatgcaggtgagcgtggtaaagaaatccaagagatgctgattcatgatgcaccaaaa
tatggtaatgatgatgattacgcagataagctagtgacagatgcttacgatatttatgtg
gatgaaatcgctaaatatccaaatactcgctatggccgcggtccaattggcggtatccgc
tactctggaacatcttctatttcagccaatgtcggtcaaggtcgtggtactttggcgacg
ccagatggccgcaatgccggaacaccgcttgctgaaggatgctcaccatctcacaatatg
gataagaacggtccaacctctgtattgaaatccgtttctaaattgccgacggatgaaatc
gttggtggcgtcttgcttaatcaaaaagtaaatcctcagactttgtctaaagaggaagat
aaactgaaactaattgccttgcttcgtacattctttaaccgtctgcatggctatcatatc
caatacaatgtcgtttctagggaaaccttgattgatgcacagaagcatcctgaaaagcac
cgcgaccttattgttcgcgttgcaggctactctgctttcttcaatgtactttctaaggcg
acgcaagatgatattatcggacggacggagcacacattgtag

DBGET integrated database retrieval system