KEGG   Streptococcus gordonii: SGO_0254Help
Entry
SGO_0254          CDS       T00594                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sgo  Streptococcus gordonii
Pathway
sgo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SGO_0254
Enzymes [BR:sgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SGO_0254
DNA repair and recombination proteins [BR:sgo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SGO_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 UvrD_C AAA_22 HHH_5 PhoH UvrD-helicase NACHT T2SSE DEAD Herpes_Helicase 5_3_exonuc DUF1257 Helicase_RecD AAA_12 FtsK_SpoIIIE RNA_helicase DUF2075 RsgA_GTPase AAA HTH_19 AAA_14 NTPase_1 AAA_25 AAA_29 AAA_28 cobW
Motif
Other DBs
NCBI-ProteinID: ABV09553
UniProt: A8AUW3
Position
complement(271661..274027)
Genome map
AA seq 788 aa AA seqDB search
MEFYFSGTVERIIFENPNNFFRILLLDIEDTDAEFDDFEIIVTGTMADIMEGQDYTFWGT
LVQHPKYGEQLKVTRYERAKPTSKGLVKYFASDHFKGIGVKTAQKIIDLYGDNTIDQILA
DPSRLVSINGLSAVNREAFVSKLRQNYGTEMLLSKLAEYGIPNKLALQIQDTYKEETLEI
VQKYPYQLVEEIQGIGFKIADQLAQQLGIESDAPERFRAGLVHTLFSQSMETGDTYIEAR
DLLAHTIDLLENARQVELDPALVADELAHLIEEDKIQNVDTKIFENSLYFAEEGIRSNLI
RILEKGKKETFGAPKLESIIEQVEQDLGICYDHIQKKAICDAINHKVFILTGGPGTGKTT
VINGIIATYATLHKLDLAKKQELPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDDD
TSHLDDYLDADFIIVDEFSMVDTWLANQLLSNISSNSKILIVGDADQLPSVSPGQVLADL
LKIRLLPQTKLTKIYRQGEDSTIVTLASQIQQGLLPANFTEKKADRSYFEASSEYIPDMI
KKIVAAAIRSGIPAQDVQVLAPMYRGPAGIDQINQLMQDLINPSEKDQLVFEAPDCQYRQ
GDKVIHLVNDAESNVFNGDLGYITDLLPAKYTDSKQDELTINFAGNEIVYQRSEWYKIRL
AYAMSIHKSQGSEFPVVILPITKSSHRMLQRNLIYTAITRSKSKLVLLGEFSAFHYAVKN
TGTARKTYLVERFADLLEREEPAEVVTTNSDTDDPIPEDGFILTLDNYLSIDPMIGIREE
DIKDIFKK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaattctatttttcaggaaccgtcgaacgcattatatttgaaaatcccaacaatttc
tttcgaattttgttactggatatcgaggacacagatgcagaatttgatgattttgagatc
attgtgaccggaaccatggccgatatcatggaaggacaagactataccttttggggaact
cttgtccagcatcccaaatacggggaacagctaaaagtaactcgctacgaaagagcaaag
ccaactagtaagggcctggtcaagtattttgctagcgatcattttaaagggatcggtgtt
aagaccgcccaaaagataatagacctctatggagataatacgattgaccagatcttagct
gatcctagccggctcgtaagtattaatggcctttctgcagtcaatcgggaggccttcgtc
agcaaacttagacaaaattacggcacagagatgttgctctctaaactcgctgaatatggc
atccccaataaacttgccttgcagattcaagatacctacaaagaagaaacgctagaaatt
gtccaaaaatatccttatcaactagttgaagaaattcaaggtattggtttcaaaatagct
gaccagttggcccagcaacttggtattgaaagcgatgctccagagcgtttccgagctggt
cttgttcatacccttttcagccaatctatggagacaggtgatacttatatagaagcacgt
gacttgctagcccacaccattgatttgctggagaatgcccgtcaggttgaacttgatcct
gccttggtagcggatgagttggcccacctcattgaagaagataagattcaaaacgttgat
acaaaaatctttgaaaacagtctttatttcgccgaagaaggtatccgtagcaatctgatt
cggattctagaaaaaggcaaaaaagaaacctttggtgccccaaaactcgaaagtatcatc
gaacaagtcgagcaagacttagggatctgctatgaccatattcaaaagaaggccatctgc
gatgccattaatcataaggtgtttattctgacgggtgggccaggaactggtaaaacaact
gttatcaacggcattattgctacttatgccactcttcacaagctagatttagctaaaaaa
caggaattacctattctgcttgctgctccgactggacgcgctgccaggcgaatgaatgaa
ttaactggactccccagtgctactattcaccggcatctagggatgactggagatgacgat
accagccatttagatgactatttggatgctgatttcatcattgtggatgagttctctatg
gtcgatacttggctggccaatcaactactcagcaatatttcttccaacagcaagattctc
attgtgggggatgctgaccaacttccgtctgtcagtcccggtcaggttctggctgatctt
ttaaaaatacgtcttttaccccaaactaaactgacaaaaatctaccggcaaggagaagat
tcaacaattgttaccctggccagtcaaatccaacaaggacttctgccggctaattttact
gaaaaaaaggcggatcgatcctatttcgaagcgtctagcgagtatatccctgacatgatt
aagaaaatcgtagccgccgccattcgcagtggcatccctgcccaggacgtccaagtcttg
gcccctatgtatcgaggacccgcgggaatcgaccaaatcaaccaacttatgcaggatttg
ataaatccatcagaaaaagaccaactggtctttgaagcaccagactgccagtaccggcaa
ggagacaaggtcatccacctggtcaatgatgctgaaagcaatgtgtttaatggggacttg
ggctatatcacggacttgttgccagcaaaatacaccgactctaaacaagatgaactaacc
atcaacttcgctggaaatgaaatcgtctatcaacgtagcgaatggtacaagattcgcctg
gcctatgccatgagtattcataaatcacaaggtagtgaatttcctgtcgtgattctgcca
atcaccaagagtagccaccggatgttgcaacgcaacctcatctatacagctattactcgc
tcaaaaagcaagctcgttcttttaggagaattttctgcctttcactatgctgtaaaaaat
acgggcacagcccgcaaaacttatctggtcgagcgttttgctgatcttttagaaagagaa
gagcctgctgaagttgtcaccactaattctgacacagacgatccaattcctgaagatggt
tttatccttactcttgataactacctcagtattgatcccatgattggaattagagaagag
gatattaaagatatttttaaaaaatag

DBGET integrated database retrieval system