KEGG   Streptococcus gordonii: SGO_0440Help
Entry
SGO_0440          CDS       T00594                                 

Definition
(GenBank) L-iditol 2-dehydrogenase BH3949
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SGO_0440
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SGO_0440
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SGO_0440
    1.1.1.-  
     SGO_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABV09535
UniProt: A8AVE6
Position
486602..487648
Genome map
AA seq 348 aa AA seqDB search
MAKMKAARWYGTKDVRIEEVDVPEVKPHQVKIAVKFTGICGTDLHEYLDGPIFIPTETEH
VYSGQKAPVTLGHEFAGEIVEVGSAVTRVKVGDRVTVEPILAKHNLVGDYNLDPNLNFVG
LAADGGFAKYCVLDGDIVHRVPDSLSYEQAALTEPAAVAVYAVRQSALKTGDTAVVFGLG
PIGLLIVEALRAAGASKIYGVELSPERQAKAEELGAIIVRPEEGEDVVAAIQRLTGGGAD
VSYEVTGVPVVLGQALAAVHKAGECMVVSIWEREASINPNEFAIQEKSLKGIIAYRHIFP
KVLELMEQGYFSADKLVTKKIKLEDIVQEGFIELTQDKAQIKILVSPE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatgaaagctgctcgttggtatggcactaaagatgttcgcattgaagaggta
gatgtaccggaagtcaaaccacatcaggttaaaattgctgtcaagttcacaggaatctgt
ggtactgacttgcatgaatacttggatggaccaatttttattccgacagaaacagagcat
gtctactctggacagaaggcacctgtaaccttgggacatgagtttgctggggaaattgtt
gaggtcggcagtgccgtgacacgggtcaaagttggcgatcgggtaacagttgagcctatt
ttagctaagcataatcttgtcggtgattataatctggaccccaatctaaactttgtcggt
ctggcggcagacggtggttttgccaagtactgtgttttggatggagacattgttcacaga
gttccagacagtcttagctatgagcaggcagccttgacagaacctgctgctgtggcagtt
tacgcggtccgtcagtcagctcttaagacgggcgatactgcggtggtcttcggtttggga
ccaattggactcttgattgtagaggctttacgagcggcgggcgcttctaagatttatggt
gttgagttatctccggaacgtcaagccaaggctgaggagcttggagccatcattgtacga
ccagaagaaggtgaagatgtggtagctgctatccagcgtttaacgggtggtggagcagat
gtgtcttatgaagtaaccggagtaccagttgttctggggcaagctttggctgctgttcac
aaggctggagaatgtatggtggtttctatctgggagcgagaagctagcattaatccaaat
gaatttgctattcaagaaaaatcactcaagggtattatcgcctatcggcatattttccct
aaggtgctggagctgatggagcaaggctacttctctgcggataagcttgtgaccaagaag
attaagctggaggatattgtacaagaaggatttattgagctgactcaggataaggctcag
attaaaattttggtatcccctgaataa

DBGET integrated database retrieval system