KEGG   Streptococcus gordonii: SGO_0459Help
Entry
SGO_0459          CDS       T00594                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00300  Lysine biosynthesis
sgo01100  Metabolic pathways
sgo01120  Microbial metabolism in diverse environments
sgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SGO_0459
Enzymes [BR:sgo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SGO_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 BMC
Motif
Other DBs
NCBI-ProteinID: ABV09754
UniProt: A8AVG5
Position
502866..504239
Genome map
AA seq 457 aa AA seqDB search
MAFFSEKEQLQKFEEDELAQAYFEVLRELIAKKSIFAQQIGLKEVADYLRDVFEEAGAEV
TVDASYRAPFVIARFKSSNPNAKSIIFYNHYDTVPADSDQPWTEDPFTLSVKDGVMYGRG
VDDDKGHIVARLTALQKYREGKKDLPVNVTFIIEGAEESASTDLDRYLEKHKEELSGADL
LIWEQGSRNALGQLEITGGNKGIVTFDAKVKSADVDIHSSFGGVIDSSSWYLLNALASLR
GANGRILVEGIYEQIVEPNERELALVEEFARRNPEELKQIYGLELPLLEEEGQKFLRRYF
FEPAINIEGISSGYQGQGVKTILPSEAKAKLEVRLVPGLEPQDVLDKIRQQLVKNGYPKV
ELIYTLGEMSYRSDMSAPSVLSVIELSKKYYREGVAVLPTSAGTGPMFTVYDALKLPMMA
FGLGHANSRDHGGDENVRLADYYTHIELVKELIASYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcttttttcagtgaaaaagagcagttacaaaaatttgaagaggatgaactcgcgcag
gcttattttgaggttttacgggagttaattgctaaaaaatctatttttgctcagcagata
ggcttgaaagaagtagcagattatttgagagacgtttttgaagaggctggcgcggaagtg
accgttgatgcaagttacagagctccttttgtcattgctcgttttaagagttcaaatcct
aatgctaaaagtattattttttacaaccactatgatacagtacctgcagatagtgatcaa
ccttggacagaagatcctttcaccttgtctgtcaaagatggggtcatgtatggccgaggt
gttgacgatgacaaggggcatatcgtggctcgcctgacagccttgcagaagtatcgagaa
ggtaagaaggatttacctgtaaatgttacttttattatagagggggctgaagagtctgcg
tcgactgacttggatcggtatttagaaaaacacaaagaagaattgtccggcgccgatctc
ctcatctgggaacagggtagccggaatgcactgggtcagctagaaatcacaggtggtaat
aaggggattgtaacctttgatgccaaagtgaaaagcgctgatgtagatatacattcgagt
tttggtggcgtaattgattcaagtagctggtatcttttaaatgcgctagctagcttgcga
ggagctaacggtcgcatcttggtggaaggcatctatgaacaaattgtcgagccaaacgaa
cgtgaactagctctggttgaggagttcgcgcgacgcaacccagaagaattaaaacaaatc
tatggtttagaattgcccctgcttgaggaggaagggcaaaagttcctacgacgttatttc
tttgaaccagctattaatatcgagggaatatcatcaggttatcaaggtcagggtgtcaag
acaatcctgccttcggaagctaaggccaagcttgaggtaagacttgtacctggcttagaa
ccacaggacgtgcttgataagattcgacaacaattagtcaagaacggttatcctaaggtc
gagcttatttatactttgggagaaatgagctacagaagcgacatgagtgctccgtctgtt
cttagtgttattgagttatctaagaaatattacagagaaggagtcgcagtgctaccaaca
tctgccggaactggcccaatgtttactgtttatgatgctttgaagctacccatgatggcc
tttggcttgggacatgctaacagccgggaccatggtggagatgaaaatgttcgcctagca
gattactacacccatatagaattagtaaaggagttgattgcaagctatgagtaa

DBGET integrated database retrieval system