KEGG   Streptococcus gordonii: SGO_0549Help
Entry
SGO_0549          CDS       T00594                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00520  Amino sugar and nucleotide sugar metabolism
sgo01100  Metabolic pathways
sgo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SGO_0549 (nagA)
Enzymes [BR:sgo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SGO_0549 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ABV10537
UniProt: A8AVQ5
Position
593710..594861
Genome map
AA seq 383 aa AA seqDB search
MPKYIKADQFFYPQGIRQGGYLEIKDGKFGKLVKEVPADAEVIDYTGYSIAPGLVDTHIH
GFGGVDVMDNNIEGTLHTMSEGLLTTGVTSFLPTTLTSSYELLLAVTENIGARYKEATGA
KIRGLYFEGPYFTEKYKGAQNPSYMKDPRMDEFRAWQKASNGLLNKIALAPERNGVEEFV
RTITDEGVTVALGHSDATFDQAKAAVEAGASVWVHAYNGMRGLTHRELGMVGAMYELPHT
YAELICDGHHVDPKACDILIKQKGHENIALITDCMTAGGLEDGDYMLGEFPVVVADGTAR
LKSTGNLAGSILKLKDGLKNVVKWGIANPHQAVMMASLIPAKSVHIDDVCGQIKEGYDAD
FIVLNDDLDLIATYLDGEKRFEA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaatatattaaagctgatcagtttttctatcctcaaggaatccgtcaaggcggt
tatttagaaatcaaagatggcaaatttggaaagctggtcaaagaagttcctgctgatgct
gaagtgattgattacactggttattctattgcacctggtctagtagatacccacattcat
ggctttggcggagtggacgtcatggacaataacatcgaaggcacacttcataccatgagt
gaaggtcttttgacaacaggggttacgagctttttaccaactactttgacttcgtcttat
gagcttttgctggctgtaacagaaaatatcggtgcccgctacaaagaggctactggtgcc
aagattcgtggcctatattttgaaggaccttatttcacagagaaatacaagggagcgcaa
aatccttcctacatgaaggatccccgtatggatgaatttcgtgcttggcaaaaggcctca
aatggcttgctgaataagattgcccttgcgcctgaacgaaatggtgtcgaagagtttgtt
cgtacgattactgacgaaggtgtgacagtagcactcggccactcagatgcaacctttgac
caagccaaggcggcagtggaagctggtgctagcgtctgggtacatgcctataacggtatg
cgtggcctgactcaccgggagctgggtatggttggtgctatgtatgagcttcctcataca
tatgcagaattaatctgcgatggccaccatgttgatcctaaggcttgcgatattctgatc
aagcaaaaaggtcatgaaaatatcgctctcattacggattgtatgacagctggcggtctg
gaagacggtgattatatgctgggtgaatttccagtggttgtggcagatggaacggctcgt
ctcaaatctacaggcaacttagctggttcaatcttgaaattaaaagatggtttgaagaat
gttgttaaatggggcattgccaatcctcaccaagccgtcatgatggctagcctgattcca
gctaaatctgttcatattgatgatgtttgcggtcagattaaagagggatatgatgcggac
tttatcgttttaaatgatgatttggacttgatagccacatacttggatggtgagaaaagg
tttgaagcctaa

DBGET integrated database retrieval system