KEGG   Streptococcus gordonii: SGO_0565Help
Entry
SGO_0565          CDS       T00594                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00010  Glycolysis / Gluconeogenesis
sgo00350  Tyrosine metabolism
sgo00625  Chloroalkane and chloroalkene degradation
sgo00626  Naphthalene degradation
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01120  Microbial metabolism in diverse environments
sgo01130  Biosynthesis of antibiotics
sgo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_0565 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SGO_0565 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SGO_0565 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGO_0565 (adhA)
   00626 Naphthalene degradation
    SGO_0565 (adhA)
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SGO_0565 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABV10952
UniProt: A8AVS1
Position
complement(610155..611177)
Genome map
AA seq 340 aa AA seqDB search
MKAVVVNPESTGVEIIQNKELRPLETGEALVEIEYCGVCHTDLHVAHGDFGKVPGRILGH
EGIGIVKELAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAQLQPGQWIVLYGAGGLGNLAV
QYAKKVFNAHVIAVDINNDKLALAKEVGADIVINGHEVDDVPGLIKEKTNGGAHSAVVTA
VSKVAFNQAVDSVRAGGRVVAVGLPSEMMDLSIVKTVLDGIQVIGSLVGTRKDLEEAFQF
GAEGLVVPVVEKRPVEDAVDVFDEMEAGTIQGRMVLDFTH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttgttgttaatccagaaagcactggtgtggaaattatccaaaacaaagaa
ctccgtccgcttgaaacaggtgaagctcttgtagaaattgaatactgtggtgtctgccac
actgacttgcacgttgcacatggtgacttcggcaaggtcccaggccgtatccttggtcac
gaagggatcggtatcgtcaaagaattggctcctgatgtaaagagcttgaaagtcggtgac
cgcgtcagtgtcgcttggttctttgaaggttgtggcacatgtgaatactgtactacagga
cgtgaaactctttgccgtacagtaaaaaatgctggttattctgttgacggtggtatggct
gaacaatgtatcgtaacagctgactatgctgtcaaagttcctgaaggtcttgatcctgca
caagcttcttctatcacttgtgctggtgtaactacctacaaagccatcaaagaagctcag
ctccaaccaggccaatggatcgtcctttatggtgcaggtggtttgggtaacctagctgtt
caatatgctaagaaagttttcaatgcccatgttatcgcagtcgacatcaacaatgacaaa
cttgccttagcaaaagaagttggtgctgatattgtcatcaatggacatgaagttgatgat
gttcctggtctcatcaaagaaaaaacaaacggcggtgctcattctgctgtcgtaacagcc
gtttctaaagtggccttcaaccaagccgttgattctgtacgtgcaggcggtcgtgtagtt
gccgttggtttgccatctgaaatgatggatctcagcattgttaagactgttctagacggt
atccaagtcatcggttctcttgtaggtactcgtaaggacttggaagaagccttccaattt
ggtgctgaaggcttagttgttccagtcgttgaaaaacgccctgttgaagatgccgtagat
gtctttgatgaaatggaagctggtactatccaaggacgtatggtacttgacttcactcac
taa

DBGET integrated database retrieval system