KEGG   Streptococcus gordonii: SGO_0671Help
Entry
SGO_0671          CDS       T00594                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00471  D-Glutamine and D-glutamate metabolism
sgo00550  Peptidoglycan biosynthesis
sgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SGO_0671 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SGO_0671 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sgo01011]
    SGO_0671 (murD)
Enzymes [BR:sgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     SGO_0671 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:sgo01011]
 Precursor biosynthesis
  Amino acid ligase
   SGO_0671 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C CbiA
Motif
Other DBs
NCBI-ProteinID: ABV10570
UniProt: A8AW14
Position
714244..715596
Genome map
AA seq 450 aa AA seqDB search
MKNIASFANKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFEENPAAQSLLEEGIKVV
TGGHPLELLDENFELMVKNPGIPYNNAMVIRALEKKIPVITEVELAYLISEAPIIGITGS
NGKTTTTTMIAQVLTAGGQNGLLSGNIGFPASQVAQSACGKDTLVMELSSFQLMGIEAFH
PQIAVITNLMPTHLDYHGSFEEYAAAKWNIQKNMTADDYLVLNFNQDWAKGMASQTQATV
VPFSTTEKVDGAYLDGDVLTFRGEAIIKVAEIGVPGSHNVENALATIAVAKLRGIDNQTI
KEVLSAFGGVKHRLQYVGQVNEVAFYNDSKSTNILATQKALSGFDNSKVILIAGGLDRGN
EFDELVPDLKGLKKMVILGQSAPRVKRAADQAGVSYLDATDVRDAAHKAFALAEPGDIVL
LSPANASWDMYSNFEVRGDEFLVAFEELKG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagcaagttttgctaacaagaaagtcttggttttaggtttggctaagtca
ggtgaatctgctgctcgccttttagataaattaggagccatcgtgacagttaacgacggt
aagcctttcgaggaaaatcctgctgcccaatccttgctagaagaaggtattaaagtagtg
acaggaggacatcctctggagttgctggatgaaaactttgaattgatggttaaaaatcca
ggtattccttataataatgctatggttattcgggctctggagaagaagattcctgttatc
actgaagttgagttggcttatctgatttctgaagctccgattattggtattacgggatca
aatggcaaaacgacgaccacgaccatgattgcgcaagtcttgacggctggtggtcaaaat
ggtcttttgtctggtaatatcggttttcctgccagtcaagtagcccaatcagcttgtggc
aaagatacactggtcatggaactgtcttccttccagttgatggggattgaggcttttcat
ccacagatagctgtgatcaccaatctcatgccgactcatctggactaccatggctctttt
gaggaatatgcagctgccaagtggaatatccagaaaaacatgacagctgatgattatctt
gttttgaatttcaatcaagattgggccaagggaatggctagccaaactcaggctactgtt
gtgccgttttcaacaactgaaaaggtggatggtgcctatcttgatggtgatgtcttgacc
ttccgtggagaagcgattataaaggtggctgaaatcggtgttcctggcagtcacaatgtc
gaaaatgctctggctactattgcagtagctaaacttcgaggcattgacaatcagacgatc
aaagaagttttgtcagcttttggaggcgttaaacatcgtctccagtatgtggggcaggta
aatgaggttgccttttacaacgacagtaagtctaccaatatcttggcaacccagaaagcc
ttgtccggttttgacaatagcaaggtgattctgattgcaggtggcttggaccgaggcaat
gaatttgacgagttggtgcctgacctcaaaggtcttaagaaaatggttatcttagggcaa
tcagctccgcgtgtaaagagagccgctgatcaggctggtgtttcttatctggatgcgact
gatgtccgggatgcagctcataaggcttttgctctagcagagccaggagatattgtcttg
ctcagtcctgccaacgccagctgggatatgtatagtaattttgaagtccgtggcgatgaa
tttctcgttgcatttgaagaattaaaaggttaa

DBGET integrated database retrieval system