KEGG   Streptococcus gordonii: SGO_0788Help
Entry
SGO_0788          CDS       T00594                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00030  Pentose phosphate pathway
sgo00480  Glutathione metabolism
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01120  Microbial metabolism in diverse environments
sgo01130  Biosynthesis of antibiotics
sgo01200  Carbon metabolism
Module
sgo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SGO_0788 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SGO_0788 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgo04147]
    SGO_0788 (zwf)
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SGO_0788 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SGO_0788 (zwf)
Exosome [BR:sgo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SGO_0788 (zwf)
  Exosomal proteins of colorectal cancer cells
   SGO_0788 (zwf)
  Exosomal proteins of bladder cancer cells
   SGO_0788 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Host_attach
Motif
Other DBs
NCBI-ProteinID: ABV11170
UniProt: A8AWC7
Position
complement(829785..831245)
Genome map
AA seq 486 aa AA seqDB search
MSSKVIVTIFGASGDLAKRKLYPSLFRLYKSGNLSKHFAVIGTARRPWSKEYFESVVVES
IADLADSPEQAQEFASHFYYQSHDVQDTEHYIELRKLQNRLNEEYQAEHNKLFFLSMAPQ
FFGTIAKHLKSENIVDGKGFERLIVEKPFGTDLESASQLNDDLLATFDEEQIFRIDHYLG
KEMIQSIFAIRFANLLFENIWNREYIDNVQITFAEKLGVEERGGYYDESGALRDMVQNHT
LQLLSLLAMDKPNSFTKDEIRAEKIKVFERLTQPSQEDLKKYFIRGQYKSGKVNGKKYIS
YRSEPNVNPESMTETFVSGAFFVDSDRFRDVPFFFRTGKRLTEKGTHVNIVFKQMDSIFG
EKLAPNVLTIYIQPTEGFSLSVNGKEVGELFSLSPISLDYRTEATASGASPEPYEKLIFD
VLNNDSTNFSHWEEVKASWKLIDQIEELWRNNQAPLHEYAVGTMGPSASAELLAQFGAEW
QWNPQN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctaaagttattgttacaatttttggagctagtggagatttggctaaacgtaag
ctctatccctcactttttagattatataagtctggcaacctttctaagcattttgctgtt
atcggaacagctcgcagaccttggagcaaggagtactttgaatctgttgtcgttgagtct
atcgctgatttagctgatagtcctgagcaagcacaggaatttgccagccacttctactat
caaagtcatgatgtgcaggataccgagcactacattgagttacgcaagcttcaaaaccga
ctcaatgaagaatatcaagcagaacacaataaactcttcttcctatccatggctcctcag
tttttcggaaccattgccaaacatctcaaatctgaaaacattgtcgatggcaaaggattt
gaacgtttgattgtcgaaaaaccttttggaacagacttggaatcagctagccaacttaat
gatgacttgttggcaacttttgatgaagagcaaatcttccggatcgaccattacctaggc
aaggagatgattcaaagcatctttgctattcgttttgccaacttgctttttgagaacatt
tggaaccgcgaatatattgacaatgtccaaattacctttgccgaaaaactgggtgtagaa
gaacgaggcggatattacgatgaatccggcgccctaagagatatggttcaaaaccatacc
ttgcaattgctgtcgcttcttgccatggataagcccaacagctttacaaaagatgagatc
cgtgcagagaaaatcaaggtttttgaacgcttgacacaaccgagccaagaagatttgaaa
aaatatttcattcgtggccaatacaaatctggaaaagtcaatggtaagaaatatatttct
tatagaagtgagccaaatgtcaatccagaatctatgactgaaacttttgtttcaggtgct
ttctttgttgacagtgaccgcttccgtgatgttcctttctttttccgcacaggtaaacgt
ttaacagaaaaagggacccatgttaacatcgtcttcaaacaaatggattctatttttgga
gaaaaactagcaccgaatgttctgaccatttatatccaaccaacagaaggtttctccctc
agtgttaatggtaaagaagtcggtgaactcttcagtttatcccctatttctttagattat
cgtacagaggcgactgcttctggagcttctcctgaaccttacgaaaaattaatttttgat
gtacttaacaatgattcaactaattttagtcactgggaggaagtaaaagccagctggaaa
ttaatcgatcaaattgaagagctctggagaaacaatcaagcgccacttcatgaatatgca
gttggaacaatgggaccatctgcttcagcagaattattagctcagtttggagctgagtgg
caatggaaccctcaaaattaa

DBGET integrated database retrieval system