KEGG   Streptococcus gordonii: SGO_1130Help
Entry
SGO_1130          CDS       T00594                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00010  Glycolysis / Gluconeogenesis
sgo00020  Citrate cycle (TCA cycle)
sgo00260  Glycine, serine and threonine metabolism
sgo00280  Valine, leucine and isoleucine degradation
sgo00620  Pyruvate metabolism
sgo00630  Glyoxylate and dicarboxylate metabolism
sgo00640  Propanoate metabolism
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01120  Microbial metabolism in diverse environments
sgo01130  Biosynthesis of antibiotics
sgo01200  Carbon metabolism
Module
sgo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_1130
   00020 Citrate cycle (TCA cycle)
    SGO_1130
   00620 Pyruvate metabolism
    SGO_1130
   00630 Glyoxylate and dicarboxylate metabolism
    SGO_1130
   00640 Propanoate metabolism
    SGO_1130
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGO_1130
   00280 Valine, leucine and isoleucine degradation
    SGO_1130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgo04147]
    SGO_1130
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SGO_1130
Exosome [BR:sgo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SGO_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Biotin_lipoyl Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C NAD_binding_8 NAD_binding_7 FAD_binding_3 DAO Trp_halogenase Biotin_lipoyl_2 HlyD_3 3HCDH_N Thi4 PYNP_C Lycopene_cycl TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABV09720
UniProt: A8AXA9
Position
complement(1176506..1178209)
Genome map
AA seq 567 aa AA seqDB search
MALEVIMPKAGVDMTEGQIVQWNKKVGEFVKEGEVLLEIMTDKVSMELEAEEDGYLIAIL
KGDGETVPVTEVIGYLGEEGENIPTAGAAAPEASPAPAASASNDDDKSDDAYDIVVIGGG
PAGYVSAIKAAQLGGKIALVEKSELGGTCLNRGCIPTKTYLHNAEIIENLGHAANRGIII
ENPSFTVDMDKVLETKNKVVNTLVGGVAGLLRSYGVDVHKGIGTITKDKNVLVNGSDLLE
TKKIILAGGSKVSKINVPGMESSLVMTSDDILEMNEVPENLVIIGGGVVGIELGQAFMTF
GSKVTVIEMMDRIVPAMDAEVSKNLRLILERKGMKILTETKLEEIIEENGKLRIKVEGKE
DIVADKALLSIGRVPDLEGIGEVEFELDRGRIKVNEYMETSVPGIYAPGDINGTKMLAHA
AFRMGEVAAENALKGNHHVAKLNLTPAAIYTLPEVAAVGLTEEQAREKYDVAIGKFNFAA
NGRAIASDAAQGFVKVIADKKYGEVLGVHIIGPAAAELINEASTIIEMEITVEEMLKTIH
GHPTFSEVMYEAFADVLGLAVHSPKKK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggctttagaagtaattatgccaaaagccggcgtagatatgacagaaggacaaatcgtc
caatggaataaaaaagtcggcgaatttgttaaagaaggtgaagtccttctagaaatcatg
accgacaaggttagcatggaattggaagctgaagaagacggctacctgattgctattctc
aaaggtgacggagaaactgttccagtaacggaagttatcggttaccttggtgaagaaggg
gaaaatatcccaacagctggagccgcagcaccagaagctagcccagcgcctgcagctagt
gcttcaaacgatgatgataagagtgacgatgcatatgacatcgtagtcattggtggtgga
cctgctggttatgtctcagccatcaaagccgctcagttaggcggtaagattgccttggtt
gagaagtctgagctcggcggaacctgcttgaatcgtggctgtattcctactaagacttac
ctgcataatgctgaaatcattgaaaaccttggtcacgctgctaaccgcggtatcattatc
gaaaatccaagctttacagttgatatggacaaggtccttgaaactaaaaacaaggttgtt
aatacgcttgttggcggtgttgctggccttcttcgtagctatggcgtagatgttcataaa
ggaattggtaccattactaaagacaagaatgttcttgtaaacggcagcgatctgctagaa
acgaagaagattatccttgctggtggttcaaaagtcagcaagatcaatgtcccaggtatg
gaatcatcacttgttatgaccagcgatgatattctagaaatgaacgaagtgccagaaaat
ctggttattatcggcggtggtgttgtcggtattgagctcggccaagccttcatgacgttt
ggctcaaaagtcactgtcattgaaatgatggaccgtatcgtacctgctatggatgcggaa
gtttctaaaaaccttcgcctcatcttggagcgcaagggcatgaaaattctgactgaaact
aagttggaagaaatcatcgaagaaaacggcaaactccgtatcaaggttgaaggaaaagaa
gatattgtcgcagataaggctctactttctatcggacgcgtgccagacctagaaggcatc
ggtgaggttgaattcgaactggatcgtggccgtatcaaggtcaatgagtacatggaaact
tctgttccaggtatttacgcaccaggtgatatcaatggtactaagatgcttgctcacgct
gccttccgtatgggtgaagttgctgctgaaaatgctctgaaaggaaatcaccacgttgct
aaactcaatctgacacctgcagctatctacaccctgccagaagtagcagcagttggtttg
acagaagagcaagctcgtgagaaatatgatgtagcaattggtaagtttaacttcgctgct
aacggccgtgctattgcttcagacgcagctcaaggcttcgttaaagtcattgctgacaag
aagtatggtgaagtgctcggtgttcatatcattggtcctgctgcagcagaattgatcaac
gaagcatcaaccatcattgaaatggaaatcaccgtagaagaaatgctgaagaccatccac
ggtcacccaaccttttcagaagttatgtacgaagcttttgcagacgtactgggtttggca
gttcactcacctaagaaaaaataa

DBGET integrated database retrieval system