KEGG   Streptococcus gordonii: SGO_1133Help
Entry
SGO_1133          CDS       T00594                                 

Gene name
acoA
Definition
(GenBank) acetoin dehydrogenase
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00010  Glycolysis / Gluconeogenesis
sgo00020  Citrate cycle (TCA cycle)
sgo00620  Pyruvate metabolism
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01120  Microbial metabolism in diverse environments
sgo01130  Biosynthesis of antibiotics
sgo01200  Carbon metabolism
Module
sgo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_1133 (acoA)
   00020 Citrate cycle (TCA cycle)
    SGO_1133 (acoA)
   00620 Pyruvate metabolism
    SGO_1133 (acoA)
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SGO_1133 (acoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ABV09385
UniProt: A8AXB2
Position
complement(1180680..1181648)
Genome map
AA seq 322 aa AA seqDB search
MATLDKSLLLEMFRKMEEIRRMDLKIAQLVKKGKVPGMTHFSVGEEAANVGAMLALNADD
LITSNHRGHGQAIAKGIDLNGMMAEILGKYTGTCKGKGGSMHIADLDAGNLGANGIVGGG
MGIAVGAALTQQMQKTGKIVVCFFGDGATNEGVFHEAVNMASIWKLPVIFYCINNGYGIS
ADIKKMTNVEHIHHRSAAYGIPGMFIEDGNNVIDVYEGFKKAVDHVRGGNGPVLIESVTY
RWLGHSSSDPGKYRTREEVELWKQKDPIENLRKYLIENNIASAEELEEIQAQVKEAIEAS
VKFAEESPFPPLESAFEDIYAD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttagacaaatctctcctattagagatgttccgtaagatggaagaaatccgt
cgtatggacttgaaaattgcacaactagtaaaaaaaggaaaagttcccggtatgactcat
ttttctgtcggggaagaagcagctaatgttggagccatgctggctttaaatgcagatgac
ctgatcacatccaaccaccgtgggcacggacaagctattgccaaagggatcgacctcaat
ggaatgatggctgaaatccttgggaagtacactggaacttgtaaaggaaaaggtgggtct
atgcacattgcagacctagatgctggtaacctcggtgccaatggtatcgtaggtggtggt
atgggaatcgcagttggggcagcgttgactcagcaaatgcagaagactggtaagattgta
gtctgcttctttggggacggtgctaccaacgaaggtgttttccacgaagcggtaaacatg
gcttctatctggaaactgccagttattttctactgcattaacaatggttatggtatctca
gcggatatcaagaaaatgaccaatgtggaacatattcatcaccgtagtgctgcttacgga
atccctgggatgtttatcgaagatggaaacaatgttatcgatgtctatgaaggatttaaa
aaagctgtagatcatgttcgtggtggcaatggtccagtcttgatcgaaagtgtaacttac
cgctggcttggtcactcatcatctgaccctggtaaatatcgtacgcgtgaagaagtggaa
ttgtggaaacaaaaagacccaatcgaaaaccttcgcaagtacctcattgaaaataatatt
gcaagtgccgaagaattggaagaaatccaagctcaagtcaaggaagcgatagaagcttct
gttaaatttgcggaagaaagtccatttccaccgcttgaatcagcatttgaagatatttac
gcagactaa

DBGET integrated database retrieval system