KEGG   Streptococcus gordonii: SGO_1135Help
Entry
SGO_1135          CDS       T00594                                 

Definition
(GenBank) Putative esterase superfamily
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Esterase Peptidase_S9 Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ABV10555
UniProt: A8AXB4
Position
complement(1183044..1183784)
Genome map
AA seq 246 aa AA seqDB search
MHVEFLSHWSGNLNREMYVNRYGHSGLPVLVFASSGGSHNEYADFGMIDACSGFIEAGKI
QFFTLSSVDSESWLADWKSPHDRAEMHRAYEHYVIQEAIPFIKHKTGWFDPIMTTGCSMG
GYHAMNFFLQHPDVFNKVIALSGVYDARYFLGDYGNDEVVYQNSPADYIWNQNDGWFIDR
YRQADIIVCTGHGAWEADGLPSFYTLKKAFDYKQIPAWFAEWGHDVAHDWVWWRKQMPYF
LNELNL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttgaatttttaagtcattggagtggaaatcttaatcgagaaatgtatgttaat
cgctatgggcattctggtcttcctgttcttgtctttgcttcttctggtggaagtcataat
gaatatgcagactttggcatgattgatgcttgctctggttttattgaagctggtaaaata
caattttttactttgagcagtgttgatagtgaaagctggttagcagattggaaaagccca
cacgatagagctgagatgcatcgtgcttatgaacattatgtcatccaagaagctattccc
tttattaaacataaaacaggatggtttgatcctataatgacgacaggctgttcaatgggt
ggttatcacgccatgaatttcttccttcaacatcccgatgtttttaataaagtaattgct
cttagcggtgtctatgatgcacgatattttttaggtgattacgggaacgatgaagtagtt
tatcagaattctccagcagattatatttggaatcaaaatgatggctggtttattgatcgt
tatcgacaggcagatatcattgtttgtaccgggcatggagcttgggaggcggatggattg
ccatctttttacactttgaaaaaagcctttgattataaacagattcctgcttggtttgct
gaatggggccacgatgtggctcatgactgggtctggtggcgtaagcaaatgccatatttc
cttaacgaactcaacctttaa

DBGET integrated database retrieval system