KEGG   Streptococcus gordonii: SGO_1140Help
Entry
SGO_1140          CDS       T00594                                 

Gene name
clpX
Definition
(GenBank) ATP-dependent Clp protease, ATP-binding subunit ClpX
  KO
K03544  ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
sgo  Streptococcus gordonii
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sgo03110]
    SGO_1140 (clpX)
Chaperones and folding catalysts [BR:sgo03110]
 Heat shock proteins
  HSP100
   SGO_1140 (clpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 ClpB_D2-small zf-C4_ClpX AAA Mg_chelatase RuvB_N AAA_5 AAA_22 Sigma54_activat MCM Sigma54_activ_2 IstB_IS21 AAA_33 AAA_16 NACHT AAA_14 T2SSE AAA_18 PhoH TsaE DEAD PduV-EutP ResIII RNA_helicase AAA_29 ABC_tran AAA_25 AAA_24 FtsK_SpoIIIE AAA_17 zf-ribbon_3 Gin B12-binding_2
Motif
Other DBs
NCBI-ProteinID: ABV09470
UniProt: A8AXB9
Position
complement(1187103..1188332)
Genome map
AA seq 409 aa AA seqDB search
MPTNRNEEMMVYCSFCGKNQDEVQKIIAGNNAFICNECVELAQEIIREELAEEVLADLSE
VPKPQELLHILNHYVIGQERAKRALAVAVYNHYKRINFHDSREEDDVELQKSNILMIGPT
GSGKTFLAQTLARSLNVPFAIADATALTEAGYVGEDVENILLKLLQAADFNIERAERGII
YVDEIDKIAKKSENVSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQEMIQVDTK
NILFIVGGAFDGIEEIVKQRLGEKIIGFGQNNKAIDENESYMQAIIAEDIQKFGIIPELI
GRLPVFAALEQLTVDDLVRILREPKNALVKQYQALLSYDDVKLEFDDDALQEIANKAIER
KTGARGLRSIIEETMMDVMFEVPSKENVKLVRITKEAVDGTDKPILETA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaaatcgtaatgaagagatgatggtatattgttcattctgtgggaagaaccaa
gatgaagttcaaaagattattgcgggtaataacgcttttatttgtaatgagtgtgtagaa
ttagcacaagaaattatccgtgaagaattagccgaagaagtcttagctgacttgtcagag
gttccaaaacctcaagaattattgcatattctaaaccattatgtcatcggccaagagcgt
gctaaaagagcgctagctgtagcggtatataatcactacaagcgcattaattttcacgat
agtcgtgaagaagatgatgttgaattgcaaaaatcaaatatcttaatgattggtccaacg
ggttctggaaaaacttttcttgctcaaaccttggctagaagtttaaatgtaccttttgcg
attgctgatgcgacagctttaacagaggctggttatgtcggagaagacgttgaaaatatc
cttttaaaacttttacaggcggctgatttcaatattgaacgtgcagaacgcggaatcata
tacgtagatgagattgataagatcgctaaaaagagtgaaaatgtttctatcacgcgcgat
gtatcaggtgaaggagtacagcaggctctcttaaaaattattgagggtactgtagcaagt
gttccgcctcaaggaggtcgcaaacatccgcagcaagaaatgattcaggttgataccaaa
aatattcttttcatcgttggtggtgcctttgatgggattgaagaaattgtaaaacaacgt
ttgggcgagaaaattattggttttggtcaaaataacaaagctatcgatgaaaacgagtcc
tacatgcaagctattattgctgaagatattcaaaaatttggaattattcctgaattaatt
ggtcgtttgcctgtttttgctgctctggaacaactgactgtagatgacttggttcgtatt
cttcgtgagcctaagaatgctttggttaaacaataccaggctctcttgtcttacgatgat
gttaaactagagtttgatgatgatgctttacaggaaatcgcgaacaaggccattgagcgc
aaaactggtgctcgcggtctacgttctatcatcgaagaaaccatgatggatgtgatgttc
gaagttccaagtaaagaaaatgtgaaacttgtccgaattactaaagaagctgttgatggt
acggataaaccaattttagagactgcttga

DBGET integrated database retrieval system