KEGG   Streptococcus gordonii: SGO_1141Help
Entry
SGO_1141          CDS       T00594                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00670  One carbon pool by folate
sgo00790  Folate biosynthesis
sgo01100  Metabolic pathways
Module
sgo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SGO_1141 (folA)
   00670 One carbon pool by folate
    SGO_1141 (folA)
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SGO_1141 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABV10304
UniProt: A8AXC0
Position
complement(1188541..1189053)
Genome map
AA seq 170 aa AA seqDB search
MTKKIAAIWAQDQNGLIGRNQSLPWHLPAELKHFKEITSGHAILMGRVTFDGMDQRVLPN
RTSLILTKDPNYTVENESVLIFHNLPSVLKWYQEQEKNLYIIGGGQIFSLFQYHLDEIIK
TEIHASFEGDTYFPKDFDLTAFREVNSQFHPKDEKNAYDFTVKILERKGS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagattgcggcgatttgggcacaagatcaaaatggactgattggaagaaat
caatccctaccttggcatttgccagcagagttaaagcattttaaagaaattacttccggt
catgctatattaatgggaagagtgactttcgatggtatggatcagcgtgttttaccaaac
cggacaagtcttattctgactaaggatccgaattatactgttgaaaatgaatctgtctta
atttttcataacttgccttctgttttaaaatggtatcaggaacaggaaaaaaatctttat
atcattggcggtggtcaaattttttccttatttcagtatcatttagatgaaattattaaa
actgaaattcatgctagttttgagggtgatacttattttccaaaggattttgacttaaca
gcatttagagaagtcaatagccaatttcatcctaaagatgaaaagaatgcctatgatttt
accgtgaagattctagaaagaaagggttcataa

DBGET integrated database retrieval system