KEGG   Streptococcus gordonii: SGO_1144Help
Entry
SGO_1144          CDS       T00594                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00010  Glycolysis / Gluconeogenesis
sgo00052  Galactose metabolism
sgo00500  Starch and sucrose metabolism
sgo00520  Amino sugar and nucleotide sugar metabolism
sgo00521  Streptomycin biosynthesis
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01120  Microbial metabolism in diverse environments
sgo01130  Biosynthesis of antibiotics
sgo01200  Carbon metabolism
Module
sgo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_1144 (glcK)
   00052 Galactose metabolism
    SGO_1144 (glcK)
   00500 Starch and sucrose metabolism
    SGO_1144 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SGO_1144 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGO_1144 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SGO_1144 (glcK)
Enzymes [BR:sgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SGO_1144 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABV09251
UniProt: A8AXC3
Position
complement(1190769..1191728)
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSIKFAILTQEGQIQEKWSIKTNILDEGSHIVDDMIESILHRLDLLQL
TADHFLGIGMGSPGVVDREKGTVIGAYNLNWKTLQPIREKIEKATGIPFFIDNDANVAAL
GERWMGAGENQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPIPCTCG
KKGCLETVASATGIVNLTRRYADEYAGEAELKKLIDNGEDVTAKTVFDLAKEEDELALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGPFLLEGIQKVYDENTFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaattattggtattgaccttggtggtacctccatcaaatttgcaatttta
actcaagaaggacaaattcaagaaaaatggtctataaaaacaaatattttagatgaagga
agccatatcgttgatgatatgattgaatctattcttcatcgtttggacttgcttcagcta
acagcagatcatttcttgggaatcggaatgggttcccctggagtagtagaccgtgaaaaa
ggtactgttattggtgcttataacctaaactggaaaactttgcaacccataagagaaaaa
attgaaaaagctactggaattccattctttatcgacaatgatgcaaatgtcgcagcatta
ggtgaacgctggatgggagctggagaaaaccaacctgatgttgtttttatgaccttagga
accggtgtaggtggcggtattgttgctgaaggcaaacttctccatggagttgcaggtgca
gcaggagagcttgggcatattactgttgattttgatcagccgattccatgtacttgcgga
aagaagggctgtttggaaactgttgcgtctgcaacaggtattgtcaacttaactcgtcgt
tatgctgatgagtacgctggtgaggctgaattaaagaaactcatcgataatggagaagac
gtcacagctaaaacagtctttgatttagcgaaagaagaagatgagttagcccttatcgtt
tatagaaacttctctcgttacctaggaattgcttgcgcgaatattggatcaatccttaat
ccatctacgattgttatcggtggcggtgtatcagctgctggacctttcttgttagaggga
attcaaaaagtttatgacgaaaataccttccctcaggttcgtacatcaacaaaattagct
ttggcaactctaggaaatgatgctggtgttatcggtgcagcatccttggttcttcaataa

DBGET integrated database retrieval system