KEGG   Streptococcus gordonii: SGO_1145Help
Entry
SGO_1145          CDS       T00594                                 

Definition
(GenBank) cell surface hydrolase
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF915 Abhydrolase_1 LCAT Hydrolase_4 Acyl_transf_1 Say1_Mug180 DUF900
Motif
Other DBs
NCBI-ProteinID: ABV10095
UniProt: A8AXC4
Position
complement(1191903..1192748)
Genome map
AA seq 281 aa AA seqDB search
MKKKFIIIFLLMIIFSFLVFFTLSNQSSKLNSSKFIQSTTPTLFFHGYGSSANAERHMTE
SARKAGVTETIIQANVDRTGQVTLRGRIPKGAINPIVMVQYEDNRNPDYLQDAAYAKAVV
EKLKQTYGFQEMKMVGHSMGNMSILYYLLEYGSEENLPKLTKQVNLANHVAGLENWNLPS
NLTLDPQTGQPSAMNEQYQKLTGLREVYPDKQIDVLNIYGDIGGNTDGSVLNVSSKALKY
LLINHAKSYKEVKISGHGGQHSRLHENSEVDQLLIDFLWRK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaatttattattatttttttactaatgatcatttttagttttttagtattc
ttcactttgtcaaatcaaagctcaaaattaaattcaagtaaattcattcaatctaccacc
ccaaccttgttctttcacggttatggctccagtgctaatgcagaaaggcatatgacagaa
tcagctagaaaggctggtgtaacagaaacaataattcaagcgaatgttgacagaacaggt
caggtcactttaagaggccgtattcccaaaggtgcaatcaatccaattgtcatggttcaa
tatgaggacaaccgaaatcctgactatcttcaagatgcagcatatgctaaagcagtagtt
gaaaaacttaagcaaacttatggatttcaagaaatgaagatggtggggcattctatggga
aatatgtccattctttattaccttttagaatatggaagtgaagaaaatctacctaaattg
actaagcaggttaatttggcgaatcatgtagctggtctagagaattggaaccttccatca
aacttgaccttagatcctcaaacaggacagccgtctgcgatgaatgaacaataccaaaaa
cttactggattaagagaggtttatcctgataaacaaatagacgttctgaatatctatggt
gatattggtgggaatacagacggctcagtcctaaatgtttcatcaaaagcattaaaatat
ttgttaatcaatcatgctaaatcctataaggaagtcaaaatatcagggcatggaggccag
catagcagattgcacgagaactctgaagtagaccagcttttaatagactttttgtggaga
aaatga

DBGET integrated database retrieval system