KEGG   Streptococcus gordonii: SGO_1152Help
Entry
SGO_1152          CDS       T00594                                 

Definition
(GenBank) Sua5/YciO/YrdC/YwlC family protein
  KO
K07566  L-threonylcarbamoyladenylate synthase [EC:2.7.7.87]
Organism
sgo  Streptococcus gordonii
Brite
Enzymes [BR:sgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.87  L-threonylcarbamoyladenylate synthase
     SGO_1152
Ribosome biogenesis [BR:sgo03009]
 Prokaryotic Type
  Other maturation factors
   SGO_1152
Transfer RNA biogenesis [BR:sgo03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    SGO_1152
 Prokaryotic Type
    SGO_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sua5_yciO_yrdC
Motif
Other DBs
NCBI-ProteinID: ABV10043
UniProt: A8AXC9
Position
complement(1204085..1204705)
Genome map
AA seq 206 aa AA seqDB search
MAKIEWWRWTMDKIENILAAGGAVVLPTETVYGLFAQALNEEAVERVYELKRRPRDKALN
LNVASLEEIYAFSKNQPTYLDQLYQAFLPGPLTIILQANDQVPTWINSGMDTVGFRIPKH
PVTLDLIRKYGPLIGPSANLSGKVSGTSFQQIVMDFQEQVSGVEDDAALTGQDSTILDLS
GEKAHILRQGAIAREDILAQVNGINF
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaagatagaatggtggcgatggacaatggataagatagaaaatattctagcggca
ggcggagcggttgtcctgccgacagaaactgtttatggcctctttgcacaggctttgaat
gaagaggcggttgagcgagtctacgaattaaaacgaagacctcgcgacaaggctcttaat
cttaatgtggctagcttagaagagatttatgctttttctaagaaccagcccacttatcta
gatcaactctaccaagcctttctgcctgggccactgactattatccttcaagccaatgac
caagtgccgacttggataaactcaggtatggatactgtaggatttcggattcctaaacat
ccggttaccttggacttgattcgcaagtacggtcccttgattggtccatccgccaatctt
tctggaaaagttagtggaacttcttttcaacagattgtgatggatttccaagagcaagtc
tcgggagtagaagatgatgcagcattgacaggtcaggattcaaccatcctggacttatct
ggagaaaaggcacatattttacgccagggagcgattgctcgtgaggatatcctcgcacaa
gtaaacggtataaatttttaa

DBGET integrated database retrieval system