KEGG   Streptococcus gordonii: SGO_1174Help
Entry
SGO_1174          CDS       T00594                                 

Definition
(GenBank) histidine kinase
  KO
K07718  two-component system, sensor histidine kinase YesM [EC:2.7.13.3]
Organism
sgo  Streptococcus gordonii
Pathway
sgo02020  Two-component system
Module
sgo_M00519  YesM-YesN two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SGO_1174
Enzymes [BR:sgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SGO_1174
Protein kinases [BR:sgo01001]
 Histidine kinases
  Other
   SGO_1174
Two-component system [BR:sgo02022]
 Other families
  YesM-YesN [MD:M00519]
   SGO_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCache_1 His_kinase HAMP Cache_3-Cache_2 HATPase_c HATPase_c_2 HATPase_c_5 DUF4094 MitMem_reg Glu-tRNAGln DUF4330 MLANA DUF3886 dCache_2
Motif
Other DBs
NCBI-ProteinID: ABV10946
UniProt: A8AXF1
Position
complement(1224825..1226528)
Genome map
AA seq 567 aa AA seqDB search
MKRYPLLIQLIVYIFLLVLVLLGLVGSLYYQTSSGTIRQLTERTTRNSMEQSGQFIASYL
QKLKQTTSTLSKEEAIRKFAQNQESSETPVQTLMKTIIETDPDLVSAVLVTKDGRVVSTD
SQISMQTSSDMMNEKWYQEAVHTKAMPVLTPARKESLSSEKEKWVVSVTQEVVDEAGQNL
GVLRLDIGYNSLKAYLDQLQLGKKGFSFIVNSQHEFVYHPKKSVYSSSQEMKAMHPYISV
KDGYADQKQAFVYQIDIADSDWTLIGVASLEQLQMLQSQMLYSFVGMGVLALLLCLIGIW
FVLRLWIKPLQNLQAVILKIGAGDSNLRAEAKGSPELVDLAQQFNKMLDQIEQLMEAVKT
EEQNVRRYELRALSAQINPHFLYNTLDTIVWMSEFNDSKRVVELTKSLAQYFRLALNQGH
EQIALKDEIDHVRQYLFIQKQRYGDKLQYEIEEDESIADYKLPKLVLQPLVENAIYHGIK
EIDRPGIIRVTSTVEEGKLLLSIYDNGCGFDLQDSSEKTLLRLGGVGLKNVDQRLRLQFG
EGYRMEIQSEQDTFTLIKIYLPLSNDK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctatccgcttcttatccagttgatcgtttatatctttcttctggttcttgta
ctcttgggacttgttgggagcctttattatcagactagctcagggaccattcggcagctg
acagagagaacgacgcgcaatagtatggagcaaagcgggcagttcattgcttcctatttg
cagaaattaaaacaaaccacctccacactgagcaaggaagaagcgattcgtaagtttgct
cagaatcaagaaagcagtgaaactcctgttcaaactttgatgaaaactatcattgaaaca
gatccagatttagtgtcggcagtattagttaccaaggacgggcgcgtggtctcgacagat
tctcaaatcagcatgcagacatcttctgatatgatgaatgaaaaatggtaccaggaagct
gtccataccaaagccatgcctgttttgacacctgctcgcaaggagtctctgtcgtcagag
aaggagaagtgggttgtttccgtcactcaggaagtagtagatgaagcagggcagaatctt
ggtgttttgcgtctggatatcggctacaatagtctcaaagcctatttggatcagcttcag
ttaggaaagaagggctttagctttattgtcaatagccagcatgaatttgtctatcatccc
aaaaagagcgtttattcatccagtcaggaaatgaaagcgatgcatccctatatctcggtc
aaggacggttacgcagaccaaaaacaggcttttgtttaccagattgatatcgcggacagc
gactggactttaattggcgttgcctcattagagcaattacagatgcttcagtcacaaatg
ctttattcttttgtgggaatgggtgttttagcactcctgctgtgcttgattggtatttgg
tttgttctgcgtttgtggattaagcctctccagaatctacaagcagtcattctgaagatt
ggggcaggtgactcaaatttgcgagcggaggctaagggttctccagagttggttgacttg
gctcagcagttcaataaaatgctggatcaaatcgaacaactaatggaagctgtcaagact
gaagaacaaaatgtccgccgttatgagctccgagctctctcggctcagatcaatccccat
ttcctttataataccttagatacgattgtctggatgtctgagtttaatgatagcaagcgt
gttgttgagctaacaaaatcactcgctcagtatttccgcttggctctcaatcaaggacat
gaacagattgctcttaaagatgagattgatcacgttcgtcagtatctttttatccagaag
caacgctatggtgacaagctccaatatgagattgaagaggatgaatctatagctgattat
aaactgcccaagctggtacttcaacctttggttgaaaatgccatctatcatggcatcaaa
gaaatcgaccgaccaggtataattcgtgtgacgtcgacagtagaggaaggaaaactgcta
ttgtctatctatgataacggctgtggctttgatctccaagattcatcggagaagactctt
cttcgccttggtggggttggtctcaaaaatgttgatcaacgcttgagattgcagtttgga
gaaggctatcgtatggaaatccagtctgagcaagatacctttactctgatcaaaatatat
ctgccactatccaatgataaatag

DBGET integrated database retrieval system