KEGG   Streptococcus gordonii: SGO_1179Help
Entry
SGO_1179          CDS       T00594                                 

Gene name
ccdA1
Definition
(GenBank) cytochrome c-type biogenesis protein
  KO
K06196  cytochrome c-type biogenesis protein
Organism
sgo  Streptococcus gordonii
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sgo02000]
    SGO_1179 (ccdA1)
Transporters [BR:sgo02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   SGO_1179 (ccdA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbD DsbD_2
Motif
Other DBs
NCBI-ProteinID: ABV10780
UniProt: A8AXF6
Position
complement(1229453..1230163)
Genome map
AA seq 236 aa AA seqDB search
MATSFLFFISVFLAGILSFFSPCILPLMPVYVGILLDSDQPKTIRIFGREVSWYGMVKTL
CFIGGLSTVFLVLGYGAGALGQVLYAPWFRYVLGGIVILLGIHQMGLINIQQLQKQKSIQ
LKKNSKRSDFLNAFLLGITFSFGWTPCVGPVLSSVLAIAASGGNGALQGGLLMLVYTLGL
ALPFLAMAMASGWVLQRFSKLKPHMGTLKKIGGALIILMGILLMLGNLNALASLFG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaagttttttgttctttatttcagtttttctggcgggaattctttcctttttc
tccccttgtatcttaccactcatgccagtttacgtaggtattctgctggattcggatcag
ccgaaaacgattcggatttttgggagggaagtttcctggtatggtatggttaaaacgctt
tgttttataggcggtttgtctactgtgtttttggttttaggatatggggctggtgctttg
gggcaagtcctctatgccccttggtttcgctacgttctgggcgggattgttattctgctg
gggatccaccagatgggacttatcaatatccaacaactgcaaaagcaaaagagcattcaa
cttaaaaagaatagtaaaagaagtgactttcttaatgcttttctcttggggattaccttt
agctttggttggacaccttgtgtaggacctgtcctaagttctgttttagctatcgctgct
tctggaggcaacggcgctcttcagggaggtttgcttatgttggtttatacacttggatta
gcgcttccttttctagcaatggctatggcttctggatgggtattacaacgcttttctaaa
cttaaaccacatatgggaacgctcaagaaaattggtggtgctctcattatacttatggga
attttgttgatgcttgggaatctaaatgctttagcatcattattcggataa

DBGET integrated database retrieval system