KEGG   Streptococcus gordonii: SGO_1181Help
Entry
SGO_1181          CDS       T00594                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K10682  two-component system, OmpR family, response regulator SaeR
Organism
sgo  Streptococcus gordonii
Pathway
sgo02020  Two-component system
Module
sgo_M00468  SaeS-SaeR (staphylococcal virulence regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SGO_1181
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sgo02022]
    SGO_1181
Two-component system [BR:sgo02022]
 OmpR family
  SaeS-SaeR [MD:M00468]
   SGO_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABV09593
UniProt: A8AXF8
Position
complement(1231337..1232035)
Genome map
AA seq 232 aa AA seqDB search
MEKTILLVDDEVDILDIQKRYLLQAGYQVLVAHDGLEGLELFKKKSVDLIITDIMMPNMD
GYDFISEVQYLAPDQPFLFTTAKTSEQDRIYGLSLGADDFIAKPFSPRELVLRVNNILRR
LQRGDETEQIELGDLVMNHVTHEVRIGDQFLELTVKSFELLWILASNPERVFSKTELYEK
VWQEDYVDDTNTLNVHIHALRQELTKRARRNTPAIKTVWGLGYKMERPRGGK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacaattttacttgttgatgatgaggtggatatcctagatatccaaaaacgt
tatcttttgcaggctggttaccaagttttagtggctcatgatggattggaaggtttagaa
cttttcaaaaaaaaatccgttgacctaatcatcacagatatcatgatgccaaatatggat
ggttatgattttatcagtgaggttcagtatttagctcctgatcaaccttttctttttaca
accgctaagaccagcgagcaggacaggatttatggattgagcttgggagcagatgatttt
atcgcgaaaccctttagccctcgagagttagttttaagagtcaataacatcttgcgtcgt
cttcagcgtggggacgagacagaacaaattgagctcggtgatttagttatgaatcatgtg
actcatgaggttcgtattggagatcaatttctagaattaacagtgaaatcctttgaacta
ctctggatattagccagtaatcctgagagagtgttctcaaagacagaactttatgagaag
gtgtggcaggaagactatgtagatgataccaacacactcaatgttcatatccatgccctc
agacaagaattgaccaagcgtgctagaaggaacactcctgccatcaaaacagtctggggg
ctagggtataagatggaaagaccacgaggtggaaaatga

DBGET integrated database retrieval system