KEGG   Streptococcus gordonii: SGO_1183Help
Entry
SGO_1183          CDS       T00594                                 

Gene name
brnQ
Definition
(GenBank) branched-chain amino acid transport system II carrier protein
  KO
K03311  branched-chain amino acid:cation transporter, LIVCS family
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Branch_AA_trans
Motif
Other DBs
NCBI-ProteinID: ABV09440
UniProt: A8AXG0
Position
complement(1234528..1235856)
Genome map
AA seq 442 aa AA seqDB search
MLRKGSLTGLLLFGIFFGAGNLIFPPALGVQSGSHFWPAIAGFVLSGVGIAIITLIFGTL
NPKGYIHEISRKIAPWFAIVYLVALYLSIGPFFAIPRTATVAYEVGISPLLPKDMTGLGL
IVFTTIYFAAAYLISLNPSKILDRIGRILTPVFAILIIILIILGAFKYGSAAPQQASAIY
AASAFGQGFLEGYNTLDALASVAFSVIAVTTLNQLGFKNKKEYVLTIWIVGLIVALAFSA
MYIGLGYLGNHFPVPAEVIAKGNPGVYVLSQATQAIFGPTAQIFLAVMVTVTCFTTTAGL
IVSTGEFFNNTFPKVSYKTYATIFTLIGYAIANLGLNAIIQYSVPVLQILYPVTIVIVMI
VIVNKFLPLSKIGMQVTVALVTLIALASILGSLFKVKEVMDTINTLPFSQASLPWLLPAL
LGIILSLILPDKQKSESFEIEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttacgaaaaggttccttaacaggtttgctgttatttggtattttcttcggtgcaggg
aatttaatctttccacctgcgttaggtgtccagtcgggtagccatttttggccagctatt
gctggatttgtcttatcaggagtagggattgcgattattaccttgatttttggtacactc
aatcctaaagggtatatccatgagatttcacgtaaaatcgctccttggtttgctatcgtc
tatctggttgctctctatttgtccatcggtcccttctttgcgattccgcggactgcaaca
gtagcctatgaagttgggatatctcctttacttcctaaagatatgactggtcttggtttg
attgttttcacgacaatttattttgctgctgcgtatctgatttctttaaatccatcaaag
attttagatcggattggtcgcattctaactccagtttttgcaattctaatcattatttta
attatactgggtgcctttaaatatggctcagcagcacctcagcaggcttcagccatctat
gctgcatcagcatttggacaaggtttcttggaaggatataatactttagatgccttagct
tcggtggcttttagcgtgattgctgtaactacactgaatcaactgggtttcaaaaataaa
aaagaatacgtcttaactatttggattgtcggactaattgttgcccttgcctttagtgct
atgtatattggcctaggatatctaggtaatcattttccagttcctgctgaagtgattgca
aaaggcaaccctggtgtttatgtcctatctcaagccactcaagctatttttggtcctaca
gcacaaatcttcctggctgttatggttacagtgacttgctttacaactacagctggtttg
attgtttcaacaggagagttctttaataatactttccccaaagtctcttataaaacttat
gcaaccatctttactttgattggttatgccattgcgaaccttggtttaaatgcgattatc
cagtattcagtaccagttttgcaaatcctttatccagttacgattgtgattgtgatgatt
gttattgtaaataaattcttacccctgtcaaaaattggtatgcaagtgacagttgcgcta
gtgactttgattgctcttgcaagcattttgggctctttattcaaagtcaaggaagttatg
gatacaataaatactttgcctttttcacaagcttctctgccttggctacttccagctctt
ttaggaattattttgtcactcattttgcctgataaacaaaagagtgaatcttttgaaatt
gaagcataa

DBGET integrated database retrieval system