KEGG   Streptococcus gordonii: SGO_1187Help
Entry
SGO_1187          CDS       T00594                                 

Definition
(GenBank) ABC transporter, permease/ATP-binding protein
  KO
K18887  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
sgo  Streptococcus gordonii
Pathway
sgo02010  ABC transporters
Module
sgo_M00706  Multidrug resistance, EfrAB transporter
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SGO_1187
Transporters [BR:sgo02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    SGO_1187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase AAA_29 AAA_15 DUF815 DUF87
Motif
Other DBs
NCBI-ProteinID: ABV11121
UniProt: A8AXG4
Position
complement(1239583..1241319)
Genome map
AA seq 578 aa AA seqDB search
MKYIWSYLRRYPKWLLLDFIGAIFFVIVNLGLPTVLARMIDEGINQGDTSRLYFWAFIML
LVIVAGVFGRIVLSYAAGKLTTSMVRDMRNDLYAKLQEYSHHEYEQIGVSSLVTRITSDA
FVLMQFAEQSLKMGVITPMMMLSSVFMIFLTSPSLAWIVAISVPFLAVVVWYVAVKTRPL
SEKQQKTLDKINQYARENLTGLRVIRAFAREEFQEERFASENEIYADNSNKLFKLTGLTE
PLFVQIIIAMIVAIVWFALQPLGSGELRIGDLVAFIEYSFHALLSFLFLSSLFTMYPRTA
VSSERLKEVMDMPISINPNEDGITETESHGYLEFDNVTFAYPGETESPVLHNVSFKAKPG
ETVAFIGSTGSGKSSLVQLIPRFYDVTLGKILVDGVDVRDYQLKALRQKIGFIPQKALLF
TGTIAENLRYGKEDASHEELNQAADVAQAKEFIESREERFETHLAEGGSNLSGGQKQRLS
IARAVVKEPDIYIFDDSFSALDYKTDAILRRRLKEVTQNSTVLIVAQRVGTIMDADQIIV
LDKGEIVGRGRHEELMESNAIYREIAQSQLNSQSLTEE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttggtcttatttaagaagatatcctaaatggctcttattggatttcata
ggagcgattttctttgttattgtaaatttaggccttcctacagttcttgctcgtatgatt
gatgaggggattaaccaaggagataccagtcgtctgtatttttgggcatttataatgtta
ttagttattgtagctggagtctttggtagaattgtcctgtcctatgcagctggcaaatta
acgactagtatggttcgggatatgagaaatgatctttacgctaagctacaagagtattct
catcatgaatatgaacagattggtgtgtcttcgcttgtgacacggataacaagtgatgct
tttgttctcatgcaatttgctgagcagagcttaaaaatgggggttattacgcccatgatg
atgctttcaagtgtttttatgatctttttaacaagtccgtccttggcttggattgttgcc
atttctgttccttttttggcggtagtggtttggtatgtggctgttaagacgcgtcctcta
tcagagaagcaacaaaaaacattggataaaattaaccaatatgctcgagagaatttaaca
ggtctacgggtcattcgtgcatttgccagagaagaatttcaagaggaacgttttgcttca
gaaaatgaaatctatgctgataactccaataaactattcaaactgacaggattaacagaa
cctttatttgttcaaatcattattgccatgattgtcgcaattgtctggtttgctttgcaa
cctttaggaagtggagaattaagaatcggtgatttagttgcctttattgagtacagtttt
catgctttactttctttcttatttttatcaagtctctttaccatgtatcctagaacagcc
gtttctagtgaacgtctgaaggaagttatggatatgcctatctccattaatcctaatgaa
gatggtattactgaaactgaaagtcatggttacctggagtttgataatgtaacctttgct
tatccaggtgagacggaaagtccagttcttcataatgtttctttcaaggccaaacctggt
gaaactgttgcctttattggttctacaggatcaggtaagtcttccttagtacaattgata
ccacgtttttatgatgttactttagggaaaattttagttgatggagttgatgtcagagac
tatcagcttaaagctttacgtcaaaagattggtttcattccccaaaaagctttgcttttt
actggtaccatcgcagaaaacttgaggtatggtaaagaagatgccagtcatgaagaacta
aatcaagctgcagatgtggctcaagctaaagaatttatcgaaagtcgcgaagagagattt
gagactcatcttgctgaaggaggaagcaatctttctggtggtcaaaaacaacgtctgtca
atcgctcgtgctgttgtaaaagagccggatatatatatctttgatgattcgttttcagct
ctcgactacaagacggatgctatcttacgtcgtcgtttgaaagaagtaacccagaattca
acggttttaatcgttgcccagcgggttggcacgattatggatgcagatcagattatcgtt
ttggataagggtgaaatcgttggtcggggaagacatgaagaactcatggaatccaatgcc
atttatcgagaaattgctcaatcccagcttaacagtcaatcattaacagaagaatag

DBGET integrated database retrieval system