KEGG   Streptococcus gordonii: SGO_1190Help
Entry
SGO_1190          CDS       T00594                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABV09485
UniProt: A8AXG7
Position
1242231..1242641
Genome map
AA seq 136 aa AA seqDB search
MIFDWKLYYLRVTEAPASSNLALISSASAVATPSLIIPGAPSTSSLASLRPRPVISRTTL
ITPTFLSPAAVNSTSNESLAAPASAAPAAATATGAAAVTPNSSSIAFTRSFNSRIEASLI
SAIMFSMFNAIVISSK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
ttgatttttgattggaaactctattacttaagagtaactgaagctccagcttcttccaat
ttagctttgatttcttcagcttctgcagttgcaacgccttctttgataattccaggtgca
ccatcaacaagttctttagcttctttaaggccaagaccagtgatttcacgtacaactttg
ataacgccaacttttttgtcaccagcagctgtcaattcaacgtcaaatgaatctttagca
gcaccagcgtcagcagcgccagcagcagctacagctacaggagcagctgcagttacacca
aattcttcttcgatagcttttacaaggtcgttcaattcaaggattgaagcttctttaatt
tcagcaataatgttttcaatgttcaatgccattgttatttcctccaaataa

DBGET integrated database retrieval system