KEGG   Streptococcus gordonii: SGO_1194Help
Entry
SGO_1194          CDS       T00594                                 

Definition
(GenBank) phosphoribosylanthranilate isomerase, putative
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01130  Biosynthesis of antibiotics
sgo01230  Biosynthesis of amino acids
Module
sgo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGO_1194
Enzymes [BR:sgo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SGO_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2204 NTP_transf_5
Motif
Other DBs
NCBI-ProteinID: ABV10622
UniProt: A8AXH1
Position
complement(1244935..1245429)
Genome map
AA seq 164 aa AA seqDB search
MDNKFIEFLKIASQLNKMGIVPLLMGSLGLEQVTGQDWQARDIDIHVHGDERGWEAPDEE
RIYDMDKIEPMMERLGYRLVDLHEHEFQKEGLSIEFGAMETLEAFSGVPLEKLTRKEVEG
VEFLLPTAEQFLAIYRASSQDSYRNENNNHKDFAKIAYLEKMTK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggataataaatttatagaatttctaaaaatcgcgtctcaactgaataagatgggaatt
gttcctctgctgatgggttccttggggctggagcaggttactggtcaggactggcaggcg
cgggatattgatattcatgttcatggtgatgaacgtggctgggaagcaccagatgaagaa
cgtatttatgatatggacaagattgagcctatgatggagcgcttgggctatcgcttagtc
gatctgcacgagcatgaatttcaaaaagaaggcttatctattgaattcggagccatggaa
accttggaggcattttcaggtgtgccactagagaagctgactagaaaagaagtagaaggc
gttgagtttctactgccaactgcagagcaatttttagctatctaccgtgcctcttctcaa
gattcttaccgaaacgaaaataacaatcataaggattttgctaagattgcttacttggaa
aaaatgacaaaatga

DBGET integrated database retrieval system