KEGG   Streptococcus gordonii: SGO_1195Help
Entry
SGO_1195          CDS       T00594                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3307
Motif
Other DBs
NCBI-ProteinID: ABV09186
UniProt: A8AXH2
Position
complement(1245449..1246156)
Genome map
AA seq 235 aa AA seqDB search
MNGFSSMDSYHLFVLLLICHLLSDYYFQSQKMADRKDKNIRVLAFHILLVGLPLFVLTII
IPSLWWKTFIVFLSHALIDYFKPILQRIFKLKVSIIFVLDQILHLAIIYGLSNMNTEFLP
SFLPLTFLKAVLFVLLVGKPTNIAFRILFGKFQPETSLELDTIDGAGAMIGFLERLVIGA
CLLYGQFASIGLVFTAKSIARYNKISESPAFAEYYLIGSLVSILSALLAAWISIK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaacggattttctagtatggattcatatcaccttttcgtacttttgttgatttgtcat
ttgttatcagattattactttcaaagtcaaaaaatggctgacagaaaggacaaaaacatt
cgagtcctggcatttcatattttacttgtagggctacctttatttgttttaactattata
ataccaagtttgtggtggaagactttcattgttttcttaagccatgctcttattgattat
ttcaaaccaatcctacaaaggatattcaagttaaaagtgtcaatcatttttgtgcttgat
caaatccttcatttggctattatctacggactctctaatatgaatactgagtttttgcca
agtttccttccattaactttcttaaaagccgttttgtttgtcttattggtaggaaagcca
accaatattgcttttagaattttatttggtaaatttcaacctgaaacgagtctggagttg
gatacgatagatggagcaggagccatgattggtttcttagagcgtttggttatcggagct
tgtcttctttatggacagtttgcttcgattggtttagtgtttacagctaaatccattgcc
cgctataacaaaatatcagaaagtccagcatttgcagagtattacttgattggatccttg
gtcagtattttgtcagccttgctcgccgcctggattagtataaaataa

DBGET integrated database retrieval system