KEGG   Streptococcus gordonii: SGO_1198Help
Entry
SGO_1198          CDS       T00594                                 

Definition
(GenBank) DNA processing Smf protein
  KO
K04096  DNA processing protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_processg_A DUF2493
Motif
Other DBs
NCBI-ProteinID: ABV09886
UniProt: A8AXH5
Position
complement(1249110..1249952)
Genome map
AA seq 280 aa AA seqDB search
MKNYDIYKMKHAGLTNGQVLNVLRYVENKEKELSLRDIAVVSECRNPALFMERYKQIDDD
FLKKSFEEFPSFSILDEIYPWDLSEIYNPPVLLFYQGNIDLLELPKVAVVGSRDSSKLGN
QSVQKIIKELNNELIIVSGLARGIDTAAHMAALQNGGRTIAVIGTGLDVFYPKANKKLQS
YIGKNHLVLSEYGPGEQPLKFHFPERNRIIAGLCRGVIVAEAKMRSGSLITCERAMEEGR
DVFAIPGSILDGKSDGCHHLIQEGAKCIMSGSDVLFEFDF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactatgatatttataaaatgaagcatgctggactgactaatggacaagttctt
aatgtcttgagatatgttgaaaacaaggaaaaggagctttctttgcgtgatatagcggtg
gtttcagagtgccgtaatcctgccctgtttatggaacgctataagcaaattgacgacgat
ttcttaaagaaatcctttgaggaatttccctctttttctatcttggatgaaatttatccc
tgggacttgagtgagatatataacccacctgttcttttgttttatcagggaaatattgat
ctacttgaattgccaaaagtagcagtagtcggaagtcgtgatagtagtaagcttggaaac
cagtccgttcagaaaattattaaagaattgaataatgaattaatcattgtgagtggatta
gcgcgtgggattgacacagctgctcatatggcagctttacagaatggtggaagaactata
gctgttattggaactggattagatgttttttatcctaaagccaataaaaaacttcagtca
tatattggcaaaaatcatctggttttatcagaatacggtcccggcgaacagcctttgaag
tttcattttcctgaacgtaatcgaattatcgcaggtttgtgcagaggcgtcattgttgct
gaagctaagatgagatctggaagcttgataacttgtgagcgagcgatggaagaaggaaga
gatgtatttgctattcctggatctattcttgatggaaagtctgatggttgtcatcatctg
attcaagaaggcgctaagtgcattatgtcaggctctgatgttctatttgagtttgatttt
taa

DBGET integrated database retrieval system