KEGG   Streptococcus gordonii: SGO_1199Help
Entry
SGO_1199          CDS       T00594                                 

Definition
(GenBank) acetyltransferase, CysE/LacA/LpxA/NodL family
  KO
K00661  maltose O-acetyltransferase [EC:2.3.1.79]
Organism
sgo  Streptococcus gordonii
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SGO_1199
Enzymes [BR:sgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.79  maltose O-acetyltransferase
     SGO_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mac Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ABV09419
UniProt: A8AXH6
Position
complement(1250079..1250657)
Genome map
AA seq 192 aa AA seqDB search
MKTEYEKMIAGEPYRPHDKELRQLAARSRNFQYSFNQEQDVRKRSAILKEWFGSTGENIS
MNPNLVCDYGVNIHLGENFYSNWNMTMLDVCPIRIGDNAMFGPNCQLLTPLHPLDPVERN
SGIEYGAPITIGDNFWAGGGVTILPGVTLGDNVVVGAGSVVTKSFGDNVVLAGNPARIIK
EIPKTKSNKALS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagaatacgaaaaaatgattgctggtgaaccctatcgccctcatgataaggaa
ttgagacagctagctgctaggtcaagaaatttccagtattctttcaaccaggaacaagac
gttcgaaaacgtagtgctattcttaaggaatggtttggctcaactggtgaaaatatttca
atgaatcctaatttagtatgtgactatggagtgaacattcatttgggagaaaatttttat
tctaattggaatatgacgatgctggatgtttgtccgattaggattggagataatgctatg
tttggtcccaattgtcaattgctaacgccattacacccattggatcctgtggaaagaaat
tctggtattgagtatggagctcccattaccattggtgataatttctgggctggaggcggt
gtgactattctgcctggtgtgacactgggagataatgtggtagtaggagcaggatcagtt
gtgaccaagtcttttggagacaatgttgttttagctggaaatccagctcggattatcaaa
gaaatccctaaaactaagtcaaataaagccctgagctaa

DBGET integrated database retrieval system