KEGG   Streptococcus gordonii: SGO_1210Help
Entry
SGO_1210          CDS       T00594                                 

Gene name
fhs-1
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00670  One carbon pool by folate
sgo01100  Metabolic pathways
sgo01120  Microbial metabolism in diverse environments
sgo01200  Carbon metabolism
Module
sgo_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SGO_1210 (fhs-1)
Enzymes [BR:sgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SGO_1210 (fhs-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF719
Motif
Other DBs
NCBI-ProteinID: ABV10337
UniProt: A8AXI7
Position
complement(1258385..1260055)
Genome map
AA seq 556 aa AA seqDB search
MKTDIEIAQSIELQPIVDVVKKIGIDYDDLELYGKYKAKLSFDKISEVRKNPVGKLILVT
AINPTPAGEGKSTITIGLADALNKIGKKTMIAIREPSLGPVMGIKGGAAGGGYAQVLPME
DINLHFTGDMHAITTANNALSALIDNHLHQGNDLGIDQRRIIWKRVVDLNDRALRHVTVG
LGSPVNGIPREDGFDITVASEIMAILCLATDIEDLKNRLANIVIGYRYDRSPVYVRDLEV
EGALALVLKDAIKPNLVQTIYGTPAFVHGGPFANIAHGCNSVLATSTALRLADYTVTEAG
FGADLGAEKFLDIKTPNLPTSPDAVVIVATLRALKMNGGVAKDALTEENVEAVRAGFANL
KRHVENIRKFGIPAVVAINEFVSDTEAEIATLKELCAEIGVPVELASVWADGAEGGVALA
EAAVKTINEEPAHYTRLYDNELSIEEKIEKIVTEIYRGSKVNFEKKAQTQIREIIKNGWD
KLPICMAKTQYSFSDNPAALGAPENFEITIRELVPKLGAGFIVALTGDVMTMPGLPKRPA
ALNMDVASDGTAIGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatattgaaattgctcaaagtattgaattacagcctattgtggatgtggtg
aaaaaaattggcatcgactatgatgacttggaactatatggtaagtacaaggctaagctt
agctttgataagatttctgaggtaagaaaaaatccagttggtaaactgattttggtaacg
gctattaatccgactccagcaggcgaagggaaatcaactattaccattggtcttgcggat
gccttgaacaagattggcaagaaaacgatgattgccatccgcgaaccgtctttggggcca
gtaatgggaattaaaggaggagcagctggcggtggctatgcgcaagtcttgcctatggaa
gacatcaacctccactttactggggatatgcatgccattacgactgccaacaatgccctg
tctgccctcattgataatcatttacatcaaggaaatgatctgggaattgatcagcgacgc
attatctggaaacgtgtggttgacttgaatgaccgagctcttcgccatgtgactgttggc
ttaggtagtccagtcaacggtattccacgcgaagatggctttgatatcacggttgcttct
gaaattatggcaattctttgcctagctacggatattgaagatttgaaaaatcgcttggca
aacattgtcatcggttatcgctatgaccgctcaccagtctatgttcgtgaccttgaggtc
gaaggtgccttggctttggtattgaaagatgcgattaagccaaatctagttcagactatt
tacggaacaccagcctttgttcatggcgggccgtttgctaatatcgcccacggctgtaac
tctgttttagcaactagtacagcgctacgcttggctgattatacggtgactgaagcagga
tttggggcagatcttggagctgagaaattcttggacattaagactccaaacttgccaacc
tctccagacgcagtagttattgttgcaacccttcgtgctcttaagatgaatggcggcgta
gctaaggatgcactgacagaagaaaatgtagaagcagttcgtgcaggttttgctaacctt
aaacgccacgttgaaaatatccgtaagttcggtattccagcagttgttgctattaatgaa
tttgtttctgatacagaagctgaaattgcaaccttgaaggaactttgtgcagaaatcgga
gtaccggttgagcttgctagcgtctgggctgatggtgccgaaggtggtgtagctttggct
gaggctgcagtcaaaaccattaatgaagaacctgctcattacactcgcctctatgacaat
gaactctctattgaagaaaagatagagaagattgtcacagaaatctatcgtggttcaaaa
gtgaactttgagaaaaaagcgcagactcagattcgggaaattatcaaaaacggctgggac
aagctgccaatctgtatggccaaaacacagtatagtttctcagacaatcctgctgctctg
ggcgctcctgaaaactttgaaattaccattcgtgagttggtaccaaaacttggggcaggc
tttatcgtggctttgacaggagatgtcatgaccatgccaggcctaccaaaacgtcctgct
gcacttaatatggatgtggcatcagatggtacagcgattggtctattttga

DBGET integrated database retrieval system