KEGG   Streptococcus gordonii: SGO_1213Help
Entry
SGO_1213          CDS       T00594                                 

Gene name
coaC
Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00770  Pantothenate and CoA biosynthesis
sgo01100  Metabolic pathways
Module
sgo_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SGO_1213 (coaC)
Enzymes [BR:sgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SGO_1213 (coaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ABV09348
UniProt: A8AXJ0
Position
1261604..1262155
Genome map
AA seq 183 aa AA seqDB search
MTQITLAVSGSISAYKAADITSRLKKENLEVAVLMTEAATEFITPLTLQVLSQRLVGLDI
MQEPDPSKVNHITIAKETDLFLLAPATANTIAKLANGLADNMVTATALALPIQTKKILAP
AMNTKMYENPLTQHNLERLQRFGWKIIQPREAVLACGDQGTGALAEIDTIIDTVKELIYE
KTV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattaccttagcagttagcggtagcatatcggcctacaaggcagctgatatc
actagccgtttaaagaaagaaaaccttgaagtagccgtcctcatgactgaggctgcgaca
gaatttatcacacctctaactctgcaagttttatctcaaaggttggttggtctagatatc
atgcaagagcctgatcctagcaaggtcaaccacattaccattgccaaggagactgacctc
tttctactagctcctgcaacggcaaatacgattgctaaattagcaaatggtctagctgat
aatatggtaacagccactgctctggccttacctattcaaaccaagaaaattttggcacca
gctatgaacacaaaaatgtatgaaaacccgctaactcagcacaatttggagcgtctgcaa
cgttttggatggaagattatccaaccacgcgaagctgttttagcctgtggtgatcagggg
acaggtgctctagctgagattgacacaattattgatacagtaaaggaacttatttatgaa
aaaacagtctaa

DBGET integrated database retrieval system