KEGG   Streptococcus gordonii: SGO_1216Help
Entry
SGO_1216          CDS       T00594                                 

Gene name
bta
Definition
(GenBank) Possible bacteriocin transport accessory protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin TraF MafB19-deam Thioredoxin_3 Thioredoxin_2 AhpC-TSA Glutaredoxin GxGYxYP_N Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ABV10860
UniProt: A8AXJ3
Position
1264770..1265117
Genome map
AA seq 115 aa AA seqDB search
MEQFAQNIKDLEVTTVDRARQAIANKETATFFVGRKTCPYCRKFAGTLAGVVAETKAHIY
FINSEEASELEKLQAFRSEYSIPTVPGFVHVQDGQVAVRCDSSMTADEIKAFAHL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatttgctcaaaatattaaagacttagaggtcacaactgttgatcgtgcccgc
caagcgattgctaacaaagagactgcaactttcttcgttggtcgcaaaacttgcccttac
tgccgtaaatttgctggaacattagctggtgtcgtagctgaaactaaagcacacatctac
ttcattaacagtgaagaagctagtgaattagagaaactgcaagccttccgctctgaatat
agcattccgacggttcctggctttgttcatgttcaagatggccaagtagcagttcgttgt
gattcttctatgactgcagatgaaattaaagcattcgctcatttataa

DBGET integrated database retrieval system