KEGG   Streptococcus gordonii: SGO_1218Help
Entry
SGO_1218          CDS       T00594                                 

Gene name
mutY
Definition
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
sgo  Streptococcus gordonii
Pathway
sgo03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SGO_1218 (mutY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sgo03400]
    SGO_1218 (mutY)
Enzymes [BR:sgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     SGO_1218 (mutY)
DNA repair and recombination proteins [BR:sgo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SGO_1218 (mutY)
 Prokaryotic Type
     SGO_1218 (mutY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD NUDIX_4 HHH
Motif
Other DBs
NCBI-ProteinID: ABV09435
UniProt: A8AXJ5
Position
complement(1265895..1267043)
Genome map
AA seq 382 aa AA seqDB search
MLDLKEYGIDMWEADKIASFRENLLTWYDENKRDLPWRRTNNPYHIWVSEIMLQQTRVDT
VIPYYERFLDWFPTVADLAQAPEDRLLKAWEGLGYYSRVRNMQKAAQQIMTDFAGKFPDS
YEGIASLKGIGPYTAGAIASIAFGLAEPAVDGNVMRVLSRLFEVDLDIGQPSNRKVFQAM
MEILIDPDRPGDFNQALMDLGSDIEAPLNPHPEDSPVKEFSAAYLHGTMDKYPIKAPKKK
PVSVYLQGLIIENEQGQFLLEKNEAAGLLSGFWHFPLIEVEEFQTENQMSLFEIAENQPS
LDLSPQESFEQDYDLIVDWQQGSFPKVQHVFSHRKWHIQLAYGRVNDSQIVADGEVMWLH
PDEFEKYPFAKPQQKMWEAFNK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttagatttgaaagaatacggaattgatatgtgggaggcagataaaattgcctctttt
cgcgagaacttattgacttggtatgatgaaaacaaacgcgacctgccttggcgcagaaca
aataatccttatcatatctgggtttctgagattatgctacagcagactagagttgatacg
gtgattccttactatgagcgttttcttgactggttcccgacagtagctgacttagcacag
gcaccagaagatagactgctcaaggcttgggaagggttaggctattattcgcgggtgaga
aatatgcaaaaagcagcccagcagataatgacagatttcgctggaaaatttcctgatagc
tatgaaggaattgctagcctcaaaggaattggaccttatacggctggtgctattgctagt
attgcctttggtctagctgagcctgcggtggacggcaatgtcatgcgggtgctgagtcga
ttgtttgaagtggatttagatattggtcaacccagcaatcggaaggtctttcaggctatg
atggagattctgattgatccagacaggcccggagatttcaatcaagcactgatggatctg
gggtcagatatcgaagctcctcttaatcctcatccagaagacagtcctgtaaaagagttc
agtgcagcctatttacatggaactatggataaatatcctattaaagcccctaaaaagaag
ccagtttcggtctatctgcagggcttgattatcgaaaacgagcagggacaattcttgctt
gaaaagaatgaagctgctggcttgttatcaggtttttggcattttcccttgattgaagtt
gaggaatttcaaactgaaaatcagatgtccctctttgagatagctgaaaatcagccaagt
ctggatttgtctcctcaagaaagctttgagcaggattatgatttgattgtcgattggcag
caggggtcttttccaaaggtgcaacatgtcttcagccatcgcaagtggcatatccagcta
gcttatggccgagttaatgatagccagatcgtagctgatggagaggtcatgtggctacat
ccagatgaatttgagaagtacccttttgccaaaccccagcagaagatgtgggaggcattt
aataaatga

DBGET integrated database retrieval system