KEGG   Streptococcus gordonii: SGO_1223Help
Entry
SGO_1223          CDS       T00594                                 

Definition
(GenBank) Adenylate cyclase
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CYTH
Motif
Other DBs
NCBI-ProteinID: ABV10808
UniProt: A8AXK0
Position
1270560..1271129
Genome map
AA seq 189 aa AA seqDB search
MNHLEIEYKSGLNKEQFESLLPLFKDITPVKQTNYYIDTPDFFIRDHKMAFRIRRFDDSA
ELTLKISQEVGTMEYNQALSADEVHSIIENMTLPEGQILENLKKTKIQLNQLNILGHLTT
IRREMKHEFGLLALDENFYFDVHDYEIELEVQDAEDGKVNFFDFLQENNLPYTPLKSKIA
RFAKNLPNS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttagaaattgaatataaatccggattaaacaaggaacagtttgaaagtctt
ctaccactttttaaagatattactccagtaaaacaaacaaattattatatagatacccct
gatttttttatcagagaccataaaatggctttccgaatccgtcgttttgatgattcagcc
gagctgactctgaagatatcgcaagaggtaggaacaatggaatataaccaagctttatca
gctgatgaagttcattctataattgagaatatgactctaccagagggacagattcttgaa
aacttgaaaaaaacgaagattcagctgaatcaattaaatatcctaggccacttaaccacc
attcgcagagaaatgaaacatgagtttggacttctagctctggatgaaaatttttatttt
gatgttcacgattatgaaatcgaacttgaagttcaagatgctgaagatggaaaagttaat
ttctttgactttctacaagaaaacaatctcccgtacacacccctaaaaagcaagatcgct
agatttgctaaaaacttgccaaatagctga

DBGET integrated database retrieval system