KEGG   Streptococcus gordonii: SGO_1225Help
Entry
SGO_1225          CDS       T00594                                 

Definition
(GenBank) pyridoxal-phosphate dependent aminotransferase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00730  Thiamine metabolism
sgo01100  Metabolic pathways
sgo04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SGO_1225
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SGO_1225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sgo03016]
    SGO_1225
   03029 Mitochondrial biogenesis [BR:sgo03029]
    SGO_1225
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:sgo02048]
    SGO_1225
Enzymes [BR:sgo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SGO_1225
Transfer RNA biogenesis [BR:sgo03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    SGO_1225
 Prokaryotic Type
    SGO_1225
Mitochondrial biogenesis [BR:sgo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SGO_1225
Prokaryotic defense system [BR:sgo02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   SGO_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABV10067
UniProt: A8AXK2
Position
1272167..1273294
Genome map
AA seq 375 aa AA seqDB search
MIYFDNAATTPLSSITIQKMTDLMGQVYGNPSSTHQHGREASKILRQARQTIAQVLRTNA
KNILFTSGATESNNTLLKGYALKHQDLGKHIITTAIEHHSVLEPLHHLAEKYGFEISFIQ
PVDGKIRVKDIKDALRPDTILVSTMFANNETGYLLPIKEIGEVLKDHPAKFHVDAVQAIG
KIPIYPEELGIDFLSASAHKFHGPKGTGFLYAKDFHFDNLLHGGSQEDKKRAGTENIISI
AGMATALENNIEHITENSSHIQELRRELLQGLDTIDYYLNEQESHLPHVLNMGFPGQVND
ILLMKLDMAGISVSTGSACTAGAIEPSHVLSAFYGETSPRLKESFRISFSDQNTVQEVQI
LTKKLKEILGETHGL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttattttgacaatgcagccacaacccctctttcgtctataactatccaaaagatg
actgatttaatgggacaggtctatggaaatccatctagcacccatcaacatggacgagag
gctagcaagattcttagacaggccaggcagactattgctcaggtattgcgaactaatgcc
aaaaatattctgttcacttctggtgctaccgaaagcaataataccctactaaaaggctat
gctctcaagcatcaagatctaggaaaacacattattacgacagcaattgagcatcattct
gttttagaacccttacaccatttagccgaaaaatacggatttgagatttcttttatccaa
ccagtcgacggaaagatacgagtaaaagatataaaggatgcacttcgtcctgacacaatt
cttgtttctaccatgtttgctaataatgagaccggttatctactacctattaaggaaatt
ggagaagttttaaaagatcatccagcaaaatttcatgtagatgcggttcaagctataggg
aagattcctatctatccagaagaattaggaattgattttttaagtgcttcagctcataaa
tttcacgggccgaagggaactggcttcttatatgctaaagatttccactttgataatcta
cttcacggtggaagccaggaagataaaaaaagagctggtacagaaaacatcatttccatt
gccggaatggccacagcactggaaaataacattgaacatataaccgaaaattccagtcat
attcaagagcttagacgcgaactcttgcaaggactggatactatcgactattatctcaat
gaacaggagtctcatttacctcatgtgcttaacatgggatttcccggccaggtaaacgat
atcctgctgatgaagttagatatggctggtatttctgtctccacaggatcagcatgtact
gctggagcgattgagccaagccacgttttgtcagctttttatggtgagacttcccccaga
ttaaaagaatcctttagaatcagtttttctgatcaaaatactgttcaagaagtacaaatt
ttaacaaaaaaattaaaagaaattttaggagaaacacatggcctttga

DBGET integrated database retrieval system