KEGG   Streptococcus gordonii: SGO_1228Help
Entry
SGO_1228          CDS       T00594                                 

Definition
(GenBank) DNA-binding protein BH0551
  KO
K01926  redox-sensing transcriptional repressor
Organism
sgo  Streptococcus gordonii
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgo03000]
    SGO_1228
Transcription factors [BR:sgo03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SGO_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Put_DNA-bind_N HTH_DeoR GFO_IDH_MocA Shikimate_DH HTH_11 Sigma70_r4_2
Motif
Other DBs
NCBI-ProteinID: ABV10334
UniProt: A8AXK5
Position
1274003..1274650
Genome map
AA seq 215 aa AA seqDB search
MKTEKNSTIPRATAKRLSLYYRIFKRFNAEKIEKASSKQIAEAIGIDSATVRRDFSYFGE
LGRRGFGYDVKKLMNFFADLLNDNSITNVMLVGVGNMGHALLHYRFHERNKMKIVMAFDV
DSHKEVGTKTPDGIPIYGISQIKEKIKDADIKTAILTVPSVKAQEVANILVDAGIKGIMS
FSPVHLHLPKEIVVQYVDLTSELQTLLYFMKKEHD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgaaaaaaattcaactattccgcgtgcgactgccaagcgtttatccctctac
taccgtatttttaaacgctttaatgcagaaaaaatagaaaaagccagttccaaacaaatt
gctgaagcaattggtattgactctgctactgttcgaagagatttttcttattttggtgaa
cttggacgcagaggttttggctacgatgttaagaaattaatgaatttttttgccgatttg
cttaatgataactcaatcaccaatgtcatgcttgtaggagttggtaatatggggcacgct
cttctccactaccgcttccatgaaagaaataagatgaaaattgtcatggcttttgatgtt
gatagtcacaaagaagttggaacaaaaacccctgatggtattccaatttatggcatttct
caaatcaaagaaaaaatcaaggatgcagacatcaagacagcaattttaactgttccaagt
gtaaaagctcaggaagtagccaatattcttgtcgatgctggaataaaagggattatgagt
ttttcacctgtgcatcttcaccttccaaaagaaattgttgttcagtatgtcgatttgaca
agcgaactacaaactcttctctactttatgaaaaaagagcatgattaa

DBGET integrated database retrieval system