KEGG   Streptococcus gordonii: SGO_1237Help
Entry
SGO_1237          CDS       T00594                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2969
Motif
Other DBs
NCBI-ProteinID: ABV09368
UniProt: A8AXL1
Position
complement(1281992..1282222)
Genome map
AA seq 76 aa AA seqDB search
MSKKDKKIEIQINDSKVKVGADLFDGYSLVIGKKVIGEIAELDGQYAIIKNGNADAFYKK
LEKAVENLIETYNLGK
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaagataaaaagattgaaattcaaattaatgatagtaaggtcaaagtagga
gcagatttatttgatggctattcgctcgttattggtaaaaaagtaattggtgagattgca
gaattagatggtcagtatgctataattaaaaacggcaatgcagatgctttctataaaaaa
cttgaaaaggctgtagaaaatttaatagaaacctataatttaggcaaataa

DBGET integrated database retrieval system