KEGG   Streptococcus gordonii: SGO_1245Help
Entry
SGO_1245          CDS       T00594                                 

Gene name
parE
Definition
(GenBank) DNA topoisomerase IV, B subunit
  KO
K02622  topoisomerase IV subunit B [EC:5.99.1.-]
Organism
sgo  Streptococcus gordonii
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sgo03032]
    SGO_1245 (parE)
   03036 Chromosome and associated proteins [BR:sgo03036]
    SGO_1245 (parE)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:sgo02048]
    SGO_1245 (parE)
Enzymes [BR:sgo01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.-  
     SGO_1245 (parE)
DNA replication proteins [BR:sgo03032]
 Prokaryotic Type
  DNA Topoisomerases
   SGO_1245 (parE)
Chromosome and associated proteins [BR:sgo03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SGO_1245 (parE)
Prokaryotic defense system [BR:sgo02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    SGO_1245 (parE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ABV11127
UniProt: A8AXL9
Position
complement(1290293..1292242)
Genome map
AA seq 649 aa AA seqDB search
MAKKEININNYNDDAIQVLEGLDAVRKRPGMYIGSTDGTGLHHLVWEIVDNAVDEALSGF
GDRIDVTINKDGSLTVSDHGRGMPVGMHAMGIPTVEVIFTVLHAGGKFGQGGYKTSGGLH
GVGSSVVNALSSWLEVEITRDGTVYKQRFENGGKPVTTLKKIGTAPKSKSGTKVTFMPDD
TIFSTTDFKYNTIAERLKESAFLLKNVRLSLTDARTGEEVEFHYENGVEDFVSYLNEDKE
TLTPVLYFEGEESGFQVQVALQYNDGYSDNILSFVNNVRTKDGGTHETGLKTAITKAMND
YARKTGLLKEKDKNLEGSDYREGLSAVLSILVPEEHLQFEGQTKDKLGSPLARPAVDSIV
SDKLTFFLLENGELASNLIRKAIKARDAREAARKARDESRNGKKNKKDKGLLSGKLTPAQ
SKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMI
YTIGAGVGSDFTLEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGRVYIALP
PLYKMSKGKGKSEVVEYAWTDGELDDLRRKFGKGAMLQRYKGLGEMNADQLWETTMNPET
RTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFTLEESGEMVF
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaagaaggaaatcaatattaataattataatgatgatgccattcaagtattagaa
gggttggatgcggtacgtaaacgtccaggtatgtatatcggatccactgacgggacagga
ctccatcatttagtgtgggaaatcgtggataatgcggttgatgaggctttatcaggtttt
ggtgatcggattgatgtcaccatcaataaagatgggagcttaacagtatctgaccatgga
cgcgggatgccagttggtatgcatgctatggggatccctactgttgaggtcatttttaca
gtattacatgctggtggtaagtttggtcaaggtggctacaagacatctggtggtctccat
ggggttggttcttcggtcgttaatgccctatctagctggttagaagtagaaattacccgt
gatggtacagtctacaagcagcgcttcgaaaatggcggaaaaccagtcactacgctcaag
aaaatcggcactgcacctaagtccaagtctggaaccaaagtgacctttatgccggacgat
acgattttttcaacgacagacttcaagtacaacactattgctgagcgacttaaggaatca
gccttcctgctcaagaatgtccgcctgtctctgacggatgctcgcactggcgaagaagta
gagtttcactatgaaaacggggttgaagactttgtcagctatctcaatgaagacaaggaa
acactgactcctgtcctctatttcgagggcgaggagagcggattccaagttcaagtggct
ctccagtataatgacggttattcagataatatcttatcctttgtcaataatgtccgcacc
aaggacggcggtacccacgagacgggtctcaagactgctattactaaggctatgaacgac
tatgccagaaagacgggtctgctcaaggaaaaggacaagaatctggaaggatcagactac
cgagagggtctatctgccgtcttatcaatcttagttcctgaggaacatttacagtttgaa
ggccagactaaagacaagttaggtagtcccttggctcgtcctgctgtggattccattgtc
tctgacaagctgactttcttcctcttggaaaatggtgagctggcttccaatctcatccgc
aaggctatcaaggctagagatgctcgggaagcggcccgcaaggcgcgtgacgaaagccgt
aatggcaagaaaaacaagaaagataagggcttactctctggtaagctaactccggcccaa
tctaagaatccagcaaagaacgaactctatctggtcgagggagactctgccggtggctct
gccaagcaaggacgcgatcgtaagttccaagccatcctgcccctacgtggtaaggttatc
aataccgctaaggccaagatggccgacattctcaagaacgaagaaatcaataccatgatc
tacacaatcggagcgggtgttgggtcagactttacccttgaggatgctaactatgacaag
atcatcatcatgaccgatgccgatactgacggtgcccatatccagaccttgctgctgacc
tttttctatcgctatatgcgtccgctggttgaagctggccgtgtctatatagccctgccg
cctctctacaagatgtccaagggcaagggaaagagcgaggttgtcgagtatgcctggacc
gatggcgagttggatgacctgcgccgtaagtttggcaaaggggctatgcttcaacgctac
aaggggttaggtgaaatgaatgccgatcaactctgggagaccactatgaaccctgaaact
cggaccctcatccgtgtcactatcgaagatctagctcgcgcagaacgccgtgtcaatgtc
ctcatgggtgacaaggtcgaaccacgccgcaagtggattgaggataatgttaagtttacg
cttgaggagagtggggagatggtgttttga

DBGET integrated database retrieval system