KEGG   Streptococcus gordonii: SGO_1247Help
Entry
SGO_1247          CDS       T00594                                 

Definition
(GenBank) 5'-nucleotidase family protein
Organism
sgo  Streptococcus gordonii
Brite
CD molecules [BR:sgo04090]
 Proteins
  SGO_1247
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sgo00537]
 Enzymes
  SGO_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos Gram_pos_anchor SLT_L
Motif
Other DBs
NCBI-ProteinID: ABV10362
UniProt: A8AXM1
Position
complement(1293067..1295253)
Genome map
AA seq 728 aa AA seqDB search
MQKKKILLPLLLLAPAFLAHQVYADEQVASEPSQEVAAAASAQEWNVPDGAIDTSVQGGE
SVSGQQSDLPEANIIHTNDVHGRIVEEKGVIGDAKLAAVIEEERKNNPSTLVVDAGDAFQ
GLPISNSSKGEERAKLLNEMGYDAMAVGNHEFDFGLDEAKKYKEILNFPLLSSNTYVNGA
RLFEASTIVDKDKNVVGDEFVVIGVTTPETATKTHPKNVQGVTFKDPISEVNSVIDEVEA
RAAAEGKTYKNYVVLAHLGVDTTTPVEWRGSTLAEALSNNPKLKGKRVTVIDGHSHTVQS
TTYGDNVTYNQTGSYLNNIGKITYKANQLLGNPQQISAASTKDVVPNAKIAAMVKKIKEA
YDAENAKVVRDNSPVELNGQRENVRVRETNLGNVVADALYEYGQTGFSHKTDLAVTNGGG
LRETIAKDKPITKGDVIAVLPFGNTISQIKVTGQNIADMFAKSLGSILQEKNGQPVLDEN
GQPLLEPSGGFLQVSGAKVYYDTTLPAEKRILHIEIKNPETGKYENLDLAKEYYLTTNDF
LAAGGDGYTMLGGAREEGPSMDVAFADYLAKADLSAYSVINPNSRTISISSKKDSDGDGV
SDIEEIKNGTDPSDPKSYPGRTDVPNGQSNQNQSGQNYQPLPNYSSNGNVVQPSPKPAGT
VTVDPAKEEKKEEVATNSKPLTVNVAKTFTSSKARLPETGTKESPALLIVTLFTAFLGIF
GFKKSQED
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaaaaaaattcttttaccgcttttattacttgctccagcatttctagctcat
caagtatacgcagatgaacaagtagcttctgaacctagtcaagaagttgcagcagcagct
tcagcccaagagtggaatgtcccagatggagctattgatacaagtgtgcaaggtggagaa
agcgtttccgggcaacaaagtgatttgcctgaagcaaatattattcatacaaatgacgtt
cacggccgtattgttgaagaaaaaggagttattggagatgctaaattagcagccgttatt
gaagaggaaaggaaaaacaatccttcaacacttgtagttgatgcgggagatgcctttcaa
ggtttgccaatttcaaatagttccaaaggtgaagagcgtgctaaactacttaatgagatg
ggctacgatgctatggctgttgggaatcacgagtttgactttggcctagatgaggcaaag
aaatataaagaaattcttaattttcctcttttaagctctaacacctatgtaaatggtgct
cgtttgtttgaagcatcaactatcgtagataaggataagaatgttgtaggtgatgagttt
gtagtaatcggtgtgacaacacctgaaactgcgaccaaaactcatcctaagaatgttcaa
ggcgtaacttttaaagatccaatttcagaagttaattcagttattgatgaagtagaagct
cgtgcagcagctgaggggaaaacatacaagaattatgtggttttggcccacttaggtgtt
gatacgactactccggtagagtggcgtgggtctactttagctgaagctctttcaaataat
ccaaagctcaaaggcaaacgcgtaacagttattgacggtcactctcatacagttcaatct
acaacttatggggacaatgttacttataatcaaactggaagttatttgaataacattggg
aaaattacttataaggctaatcaattattaggaaatccacaacaaatctctgcagcttct
actaaagatgttgtaccaaatgctaaaatagcagctatggtcaagaaaattaaggaagct
tatgatgctgaaaatgctaaagtggtccgtgataacagtccagttgagctaaacggccag
cgtgaaaatgttcgggttcgtgagaccaatcttggtaatgtggtagcggacgccctttac
gaatacgggcaaactggatttagccataaaacagatcttgctgtgacaaacggtggtggt
ttgcgtgaaacaattgccaaagataagccaattacaaaaggtgatgtgatcgcagttctt
cctttcggaaacactatttctcaaatcaaagtaacgggacaaaacattgctgatatgttt
gctaaatctcttggatccatcttacaagaaaaaaatggccagcctgttttagatgaaaat
ggacaacctcttcttgaaccaagcggaggcttcctacaggtttcaggtgctaaggtttat
tacgatacaaccttgcctgctgaaaaacgtattttgcatattgaaattaaaaacccagaa
accggtaagtatgaaaacttagatcttgctaaagaatactatttgacaacaaatgatttc
ttagcagccggtggtgatggctacaccatgttgggtggtgcgcgagaagaaggcccttct
atggacgttgcttttgctgactatctagctaaagcagatttaagtgcatattcggttata
aatccaaattcccgtacgatttctatttcttctaaaaaagatagcgatggagatggagtt
tctgatattgaagaaatcaaaaatggaactgatccatctgatccaaaatcttatcctggc
agaacagatgttccaaatggccagtctaatcagaatcaaagtggccaaaactatcaacct
cttccaaattactcttcaaatggcaatgtagttcaaccgtctcctaaaccagcaggcaca
gtcacagtagaccctgcaaaagaagagaagaaggaagaagttgctacaaacagtaagcct
ttgacagttaatgttgctaaaacatttacatcatctaaggctagacttcctgaaacagga
acaaaagagtcaccagctttacttattgtaaccttgtttactgctttcttgggaatcttt
ggtttcaagaagagtcaagaagactaa

DBGET integrated database retrieval system