KEGG   Streptococcus gordonii: SGO_1248Help
Entry
SGO_1248          CDS       T00594                                 

Gene name
pyrC
Definition
(GenBank) dihydroorotase
  KO
K01465  dihydroorotase [EC:3.5.2.3]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00240  Pyrimidine metabolism
sgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGO_1248 (pyrC)
Enzymes [BR:sgo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     SGO_1248 (pyrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 DHOase
Motif
Other DBs
NCBI-ProteinID: ABV10829
UniProt: A8AXM2
Position
complement(1295394..1296662)
Genome map
AA seq 422 aa AA seqDB search
MLLIKNGRVMDPKTGFNQIADLLVEGKKIVKIGQDLQAEGAKVIDASGLVVAPGLVDIHV
HFREPGQTHKEDIHTGALAAAAGGFTTVVMMANTNPTISTVETLKEVLESASRENIHIKS
VATITENFDGQHLTDFQGLLAAGAVGFSDDGIPLTNAGIVRQALVEARKNDTFISLHEED
PNLNGILGFNEHIAKEHFHICGATGVAEYSMIARDVMIAYDAKAHVHIQHLSKAESVKVV
EFAQKLGAQVTAEAAPQHFSKTEALLLTKGSNAKMNPPLRLESDRLAVIEGLKSGVISVI
ATDHAPHHADEKNVEDITKAPSGMTGLETSLSLGLTYLVEAGHLSLMELLEKMTVNPARL
YGFDAGFIAQDGPADLTIFDPEESRLVTDHFASKAANSPFVGEKLKGQVKYTICDGEVVF
EG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctattaatcaaaaacggacgagttatggatcctaagactggttttaaccaaattgct
gacctcttggttgaggggaagaaaattgtcaaaatcggtcaagatttgcaggcagaagga
gcaaaagttattgatgccagtggtttggttgtggctccaggtttggtggatatacacgtt
cattttagagaacctggccagactcataaggaagacattcatacgggggctttggctgca
gcagcaggtggctttacgacagttgttatgatggctaataccaatccgaccatctctaca
gttgaaaccctgaaagaagttctggagtcggctagtcgggaaaatatccatattaagtca
gtcgcaacgatcactgagaattttgatggtcagcatttgacagatttccaaggtctcttg
gcagctggtgcagtaggtttttctgatgacggtattccactgaccaatgctggcattgtc
cgccaagcccttgtagaagcgcgtaaaaatgacacctttatcagcttgcacgaggaagat
cccaatctcaacggcatacttggtttcaatgagcatattgccaaagagcattttcatatc
tgtggcgcgacaggtgtggcagaatacagcatgattgctcgcgatgttatgattgcttat
gatgcaaaggctcatgtgcatattcagcatttgtccaaggctgagagtgtaaaggttgtg
gaatttgctcagaagctaggtgctcaagtcactgctgaagcagcacctcagcacttttct
aagacagaagctctgctattgaccaagggcagcaatgctaagatgaatccgcctttacgc
ttagaatcggaccgtctggcggttatcgaggggctcaaatctggtgtcatttctgtcatt
gcgacggaccatgctccccatcatgctgacgagaaaaatgttgaagacatcactaaagca
ccttctggcatgactggtcttgaaacttcgctttctctgggactgacctacctagttgag
gctggtcatctgagcttgatggaacttttggagaaaatgacagtcaatccagcacgtttg
tatggttttgatgctggcttcattgctcaggatggccctgccgatttgacaatatttgac
ccagaagagagtagactagtgactgaccactttgcctccaaggcagccaattcacctttt
gttggtgaaaagcttaaaggtcaagtgaagtacaccatctgtgacggggaagttgttttt
gaaggataa

DBGET integrated database retrieval system