KEGG   Streptococcus gordonii: SGO_1252Help
Entry
SGO_1252          CDS       T00594                                 

Definition
(GenBank) integral membrane protein, putative
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT_2 ALMT
Motif
Other DBs
NCBI-ProteinID: ABV11110
UniProt: A8AXM6
Position
complement(1298591..1300222)
Genome map
AA seq 543 aa AA seqDB search
MPKEKQQSLDCCIFLAITLDFCYNKPMSKIYRLSFSILQKIMLVLVVHWFFVSIFYISEM
SYWAYPIFGILLIGAYYYRKEVLKVYRYLMRHKLAIMLAAIIFQLIMIWAAELLVRRDAA
VVLNGAFRLLKETSISSYITRNPNNLPLFLYERFFYKLFGESSALWIMQGLNMVYTNLTA
LILYKGSQKFFNQKSADVVFSLYVLLAGFSPYFFSMYTDIPPLPFISLQIFLIFGIFKAD
SIKKLTALSISLGLLTGFLYFVRPTVMILLIAFFVTFFLQKQWKSFLLVLSIFVLAFGIT
YSGLHTAIKNQNEVTIIQKEGLAKGPLLFINLGLTYIGHNQADMKEGLLQYIEASKRDDY
NNGMFAKENVIKEIKRRLKEYTPATFWGHLYYKQSLTVAEGTLGWLYRDVENEKTPFINP
LYEMTKNNPLAQFVRTFFLSIDKKEYVYYALIKQFVWIVMSLGLVMTLWKYRPDDRVNFL
NLAVFGGLLFLQIFEGGKTRYLIQFLPQILLVSALGLSQYSQDLKKVVCYLKISQRKSLK
RND
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
ttgccaaaagaaaagcagcagtctcttgattgctgtattttcttagctataacccttgat
ttttgctataataagcctatgtcaaagatttatcgtctatcgttttctattttacaaaaa
atcatgttagtccttgtagtacattggttttttgtttcaatcttttatatcagtgagatg
agttattgggcctatccaatttttggtattttgctgattggagcttattattatcgtaaa
gaagttttaaaagtataccgctatttgatgcgacataaattagcgatcatgctagctgcg
attatttttcagcttattatgatttgggcggctgagttgctggtgcgtcgggatgcagca
gttgttctgaacggggcatttcgcttacttaaagaaacatcgatttcaagctatatcaca
cgtaacccaaataacttacctctctttctctacgaacgctttttctacaagctgtttggg
gagtcgtctgcactttggataatgcagggactaaacatggtgtatactaatctaacagct
ttgattttgtataagggaagtcaaaaattctttaatcaaaaatcggctgatgtcgttttt
agtctttatgtgcttttggctggattttctccttatttcttctctatgtatacggatatt
ccgccactgccctttatttctttacagattttcttaatttttggaatctttaaagctgac
agtattaagaaattgactgccttaagtatttcgttggggctgctaacaggcttcttatat
tttgttcgcccgacagtcatgattctcttgattgccttcttcgtaacattctttttgcag
aagcagtggaaaagttttcttttggttttatcaatatttgtccttgcttttgggataacc
tatagtggacttcatacggctattaagaaccagaatgaagtgacaattattcaaaaagaa
ggattagctaagggaccgcttctctttatcaatttggggcttacatacataggtcataat
caagcagatatgaaagaagggttacttcaatatattgaagccagcaagagagatgactat
aataatggcatgtttgctaaggaaaatgtcattaaggaaattaagcgtcgcttgaaggaa
tatacacccgctacattttgggggcacttatattacaagcaatctctaacggtggcagaa
gggactctgggttggctctatcgggatgttgaaaatgaaaagacaccatttattaatcct
ttatacgaaatgaccaaaaacaatccacttgctcagtttgttcgaacattctttttaagc
attgataagaaggagtatgtctattacgctcttatcaagcagttcgtttggattgttatg
agtctaggtctcgttatgactttgtggaagtaccgacctgatgatcgcgtcaacttttta
aatcttgctgtttttggtggcttactcttcctacagatttttgaaggtgggaaaacccgt
tacctcatccaatttttaccacagattttactggtttctgctcttggtttaagtcagtat
tctcaagatttgaagaaagtcgtctgttacttaaaaatttcccaacgaaagtctttgaaa
aggaatgattaa

DBGET integrated database retrieval system