KEGG   Streptococcus gordonii: SGO_1254Help
Entry
SGO_1254          CDS       T00594                                 

Gene name
pyrF
Definition
(GenBank) orotidine 5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00240  Pyrimidine metabolism
sgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGO_1254 (pyrF)
Enzymes [BR:sgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     SGO_1254 (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-ProteinID: ABV10863
UniProt: A8AXM8
Position
complement(1300988..1301680)
Genome map
AA seq 230 aa AA seqDB search
MREERPIIALDFPSFDDVKAFLEHFPEDEKLFVKIGMEFFYAIGPEIVHYLKGLGHSIFL
DLKLHDIPNTVRSAMSVLGTFGIDMVTVHAAGGVEMMSEAKKVLGDKAKLVAVTQLTSTS
EEDMRDCQNIQTTVQESVVNYARKAKEAGLDGVVCSAQEVELIKAATAEDFLCVTPGIRP
AGSEIGDQKRVMTPQEAHQIGSDYIVVGRPIIQAENPWDAYHEIKKQWNS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagaacgtcctattatcgccctcgactttccatcttttgacgatgtcaaagct
tttctggagcattttccagaagatgaaaaactttttgtaaaaatcggtatggaattcttc
tatgctatcggtccagaaatcgttcattatttgaaaggtcttgggcacagtattttcttg
gatttgaagctacatgacattcccaatactgtgcgctcagccatgtctgtcttaggtact
tttggcattgacatggtgacggtccatgcggctggcggtgtagagatgatgagcgaagcc
aagaaggttttgggagataaggctaagttggttgcggtgactcagctgacctcaacaagt
gaggaagatatgcgtgattgccaaaacatccaaactacggttcaggagtctgttgtcaat
tatgctcggaaggctaaagaagctggcttggatggcgtagtttgctcagctcaagaggtt
gaactgattaaggcagcaaccgcagaagactttctctgtgtgacgccgggtattcggcca
gctggatcagaaatcggtgaccaaaagcgggtcatgactccgcaggaagcccatcaaatc
ggcagtgattatattgtagtcggccgtccgattatccaagctgaaaatccttgggatgct
tatcatgaaatcaagaagcagtggaatagctaa

DBGET integrated database retrieval system