KEGG   Streptococcus gordonii: SGO_1256Help
Entry
SGO_1256          CDS       T00594                                 

Definition
(GenBank) Dihydroorotate dehydrogenase electron transfer subunit
  KO
K02823  dihydroorotate dehydrogenase electron transfer subunit
Organism
sgo  Streptococcus gordonii
Pathway
sgo00240  Pyrimidine metabolism
sgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGO_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHODB_Fe-S_bind NAD_binding_1 FAD_binding_6 Transketolase_C NAD_binding_6 DUF3903 Fer2
Motif
Other DBs
NCBI-ProteinID: ABV10642
UniProt: A8AXN0
Position
complement(1302881..1303687)
Genome map
AA seq 268 aa AA seqDB search
MVSDSCKKRFGKIMLEQMELLEQVEIAPNIFSMLLKGQMVNQMQAGQFLHIRVPDDSKLL
RRPISIAEIDRDNLTCRIIYRIEGGGTAIFSHLPVGSFLDVMGPQGNGFDLSPVRAGDHA
LIIGGGIGVPPLLEVAKELHAKGAQVTAVLGFADKSAVILEAEMKKYADVIVTTDNGSYG
RKGYVSAVVDEMIQDYEAVYSCGAPAMLQYVDRKFQDHPHAYLSMESRMACGMGACYACV
VHVAGQDESVNKRVCEDGPVFETGTIIV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggttagtgacagttgcaaaaagagatttggtaagattatgctggagcagatggagctg
ctagagcaagttgagattgcacctaatattttttccatgctcctaaagggccaaatggtc
aaccagatgcaggctgggcagtttttacatattcgagtaccagatgacagcaagcttttg
cgccggcctatctcaatcgcagagattgaccgagacaatctgacttgtcgtatcatttat
cggatagaaggtggcgggacggctattttttctcatcttccagttggctcgtttcttgat
gttatgggtcctcaaggcaatggctttgatttgagtcctgtaagggcaggtgaccacgct
ttgattatcggtggtgggattggtgtccctcctctgcttgaggttgctaaagaattgcat
gcaaagggtgctcaagtgacagctgtgctgggattcgctgataaatctgctgttattttg
gaagcagaaatgaaaaaatacgctgatgtcattgtcacgacggataatggttcctatggt
cgcaagggctatgtatcagcggtggtagatgagatgatccaagactatgaggctgtctat
tcctgtggagcgccagctatgcttcagtacgtcgatcgtaagtttcaggaccatccgcat
gcttatctctccatggaatcacgtatggcttgtggtatgggcgcttgctatgcctgcgtc
gttcatgtggcaggtcaggacgagtcagtcaataagcgcgtttgtgaagacggcccggtc
tttgaaacgggcacgattattgtctag

DBGET integrated database retrieval system