KEGG   Streptococcus gordonii: SGO_1260Help
Entry
SGO_1260          CDS       T00594                                 

Gene name
deoD
Definition
(GenBank) purine nucleoside phosphorylase
  KO
K03784  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00230  Purine metabolism
sgo00240  Pyrimidine metabolism
sgo00760  Nicotinate and nicotinamide metabolism
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SGO_1260 (deoD)
   00240 Pyrimidine metabolism
    SGO_1260 (deoD)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SGO_1260 (deoD)
Enzymes [BR:sgo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     SGO_1260 (deoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ABV10410
UniProt: A8AXN4
Position
complement(1306325..1307038)
Genome map
AA seq 237 aa AA seqDB search
MSIHIAAQQGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVM
GTGMGMPSISIYARELIVDYGVKKLIRVGTAGSLNEDVHVRELVLAQAAATNSNIIRNDW
PQYDFPQIASFDLLDKAYHIAKDLGMTTHVGNVLSSDVFYSNYFEKNIELGKWGVKAVEM
EAAALYYLAAQHHVDALAIMTISDSLVNPEEDTTAEERQNTFTDMMKVGLETLIAEA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtctatccatattgctgctcagcaaggtgaaattgctgataaaattcttcttccaggg
gatcctcttcgtgcgaaatttattgcggagaacttccttgaagatgctgtttgttttaac
gaagtgcgtaacatgtttggttacactggtacttataaaggtcaccgtgtttctgtcatg
ggaactgggatgggaatgccttcgatttctatctatgcgcgtgagttgattgttgactac
ggggttaaaaaattaatccgtgtcggaactgcaggttcgttaaacgaagatgtccatgtt
cgtgaattggttttggcacaggcagctgcaactaactcaaacattatccgtaatgactgg
ccacagtatgattttccgcaaattgctagctttgatttactagacaaggcctaccatatt
gccaaagatctcggtatgaccacccacgttggtaatgttttgtcttctgatgtcttttat
tcaaactactttgaaaagaatatcgagcttggaaaatggggagttaaagctgtggaaatg
gaagcagcagctctctactacttggcggctcaacaccatgtggatgctcttgctattatg
actatttctgacagcttggtcaatccagaagaggatacaactgcagaagagcgtcaaaat
accttcaccgatatgatgaaggttggtttggaaaccttgattgctgaagcatga

DBGET integrated database retrieval system