KEGG   Streptococcus gordonii: SGO_1261Help
Entry
SGO_1261          CDS       T00594                                 

Definition
(GenBank) glutamine amidotransferase, class I
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00230  Purine metabolism
sgo01100  Metabolic pathways
Module
sgo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SGO_1261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sgo01002]
    SGO_1261
Enzymes [BR:sgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     SGO_1261
Peptidases [BR:sgo01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   SGO_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABV09765
UniProt: A8AXN5
Position
complement(1307260..1307970)
Genome map
AA seq 236 aa AA seqDB search
MKVHFVLHETFEVPGAYLKWALERGHHITTTKVYEKEPLPETIDGIDFLIVMGGPQSPDE
DRENFPYYDPKAELSFMKEAIAADIYIVGVCLGAQLLSVAYGAKYEHSPEREIGIFPITL
TEAGLKDEHVKILGPTLITGHWHGDMPGLTENAVVLATSQGCPRQIIRFSPKHYAFQAHL
EFDPEAVELLIAADGEEVLEDQSQKLTFVQNPEVIRAYDYQEMNTKLYAFLDSLVN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtacattttgtactgcatgaaacatttgaagtgccaggcgcttatctcaaatgg
gctctggaacgaggtcatcacattacaacaacaaaggtttacgaaaaagaacctcttcct
gaaacaattgacgggattgactttctgattgtcatgggtggtcctcaatctcccgatgag
gatagagaaaacttcccatattatgatccaaaggctgagctttcttttatgaaagaagcg
attgctgcagatatctatattgttggtgtttgtcttggtgcgcagcttctatctgttgct
tatggtgcgaagtatgaacatagtccagagcgtgagattggtatttttccaataactcta
actgaagctggtttaaaagacgagcatgtcaaaattctcggaccaactctaattaccgga
cactggcatggtgatatgcctgggctgacagagaatgctgttgttcttgcgacgagtcaa
ggttgtccacgtcagattattcgcttcagtccgaaacattatgcctttcaggctcatttg
gaatttgatccagaagctgttgaactattaattgcagcggatggtgaagaggtcttggaa
gaccaaagccaaaaattgacctttgtccaaaatcctgaagtcattcgagcttatgattat
caagaaatgaatacaaaactgtatgcatttttagattcattggtaaactag

DBGET integrated database retrieval system