KEGG   Streptococcus gordonii: SGO_1264Help
Entry
SGO_1264          CDS       T00594                                 

Gene name
deoB
Definition
(GenBank) phosphopentomutase
  KO
K01839  phosphopentomutase [EC:5.4.2.7]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00030  Pentose phosphate pathway
sgo00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SGO_1264 (deoB)
  Nucleotide metabolism
   00230 Purine metabolism
    SGO_1264 (deoB)
Enzymes [BR:sgo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.7  phosphopentomutase
     SGO_1264 (deoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: ABV10973
UniProt: A8AXN8
Position
complement(1310133..1311344)
Genome map
AA seq 403 aa AA seqDB search
MAKFNRIHLVVMDSVGIGAAPDANNFVNAGVPDGASDTLGHISKTVGLTVPNMAKIGLGN
IERPVPLKTVPQEANPSGYYTKLEEVSLGKDTMTGHWEIMGLNITEPFDTFWNGFPEEIL
TQIEEFSGRKVIREANKPYSGTAVIDDFGPRQMETGELIIYTSADPVLQIAAHEEVIPLE
ELYRICEYARSITLDRPALLGRIIARPYVGEPGNFTRTANRHDYAVSPFEPTVLDKLNEA
GIDTYSVGKINDIFNGAGINHDMGHNQSNNHGVDNLVKALKDENFKHGFSFTNLVDFDAL
YGHRRNPHGYRDCLEEFDARIPEIIENMREDDLLMITADHGNDPTYAGTDHTREYIPLLI
FGKSLSGHGHIPVGHFADISATVAENFGVDKAMIGESFLDKLV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttaatcgtattcacttagtagttatggactcagttggtattggtgcagca
ccagatgctaacaactttgttaatgctggagtgccagacggtgcttcagatactctggga
catatttccaaaacagttggacttacagtccctaatatggctaagattggtctgggaaat
atcgaacgtcctgttcctttgaagacagttcctcaggaagcaaatccaagtggctattat
actaaacttgaggaagtatcacttggaaaagacacgatgactggccactgggaaatcatg
ggactaaatattactgaaccatttgatactttctggaatggtttcccagaagaaatcttg
actcagattgaagagttttctggacgtaaagttattcgtgaggctaataaaccttattca
ggaacagcagttattgatgactttggtcctcgtcagatggaaacgggcgagctaattatc
tatacttctgcggatccagtattgcagattgctgctcatgaagaagtgattccattggaa
gaactctatcgcatttgtgaatatgctcgttcaattactttggatagacctgcgcttcta
ggacgtatcattgcccgtccatatgttggtgaaccaggaaacttcacccgtactgctaat
cgtcacgactacgcagtatcaccattcgagccaactgtacttgataagctaaatgaagcg
ggaatcgatacatactctgttggtaagatcaacgacatcttcaatggagctggaatcaac
catgacatgggccacaatcaatctaataatcatggagtagataatttagttaaagcattg
aaggacgaaaacttcaaacatggcttctcctttactaacttagtagactttgatgctctt
tatggtcaccgtcgtaatccacatggctatcgcgactgtttggaagagtttgatgctcgt
attcctgaaatcattgaaaatatgcgtgaagatgacttgctcatgattactgctgaccat
ggtaatgaccctacctacgctggtactgaccatactcgtgaatatatccctctcttaatt
tttggaaaatctttaagcggtcacggtcatattcctgtcggacactttgcggatatctca
gctactgttgctgagaactttggagtggacaaggcaatgattggtgaaagtttcttggat
aaattggtgtaa

DBGET integrated database retrieval system