KEGG   Streptococcus gordonii: SGO_1268Help
Entry
SGO_1268          CDS       T00594                                 

Definition
(GenBank) murein hydrolase export regulator
Organism
sgo  Streptococcus gordonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LrgB DUF3981
Motif
Other DBs
NCBI-ProteinID: ABV10674
UniProt: A8AXP2
Position
complement(1314798..1315496)
Genome map
AA seq 232 aa AA seqDB search
MTSVVTNPLFGLALSILAYLIGMLIFRRFPHPLTTPLLLATILVILFLSWTEISYKDYYI
GGSYLNNLIVPSTVALGIPLYKTFHLMKHHARSILLGISLSVLVNTSFTALVAKFFGMDF
FLAISLFPKSVTTAMAVGIVDKMQGITTITLVVVVATGILTSVMGPTILKLLKIEDPVAI
GLALGGTGHAVGTGAAFKYGQVEGAMAGLAIGVTGLMYVFVSPLIAGLILGK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgactagtgtagttactaatcctttgtttggtttggctttgtctatcttagcctatctt
attggaatgctgatttttagacgttttccacatcctttgacgacacccttgctgctggca
acaattttagtaattctctttttatcttggactgagatttcttacaaggattattatatc
ggaggatcatatttgaataatctgattgtaccttcgacagttgctttagggattccgctt
tacaagactttccatttaatgaaacaccacgctagaagtatcttattaggtatctcttta
tcagttttggtaaatacaagttttacggcacttgtagcaaaattttttggaatggacttt
ttccttgctatttctttgtttccaaagtcagtaaccactgcaatggcagttggtattgtt
gataagatgcaggggatcacaacaattactttagtagttgttgtagcgacagggattttg
acaagtgttatggggccgactattttaaaacttcttaaaattgaagatcctgttgctatt
ggcttagcacttgggggaactgggcatgcagttggaacaggagcagcctttaaatatggt
caagttgagggagctatggctggtttagccattggagttacaggtttaatgtatgttttt
gtcagtcctttgattgctggactcattttaggaaaataa

DBGET integrated database retrieval system